Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone VT-23-1

ACC No: AJ579773

Dated: 2003-12-04 | Length: 632 | CRC: 1039090883

                !!NA_SEQUENCE 1.0
ID   CTR579773  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579773;
XX
SV   AJ579773.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone VT-23-1
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6D6; Q7T6D6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="Israel"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="VT-23-1"
FT                   /isolate="VT"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6D6"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30355.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVSLEADRLEFLRKMNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKREARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEEAPEH
FT                   YKFGMTAKAMLPNINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 632 BP; 193 A; 122 C; 159 G; 158 T; 0 other;

AJ579773  Length: 632  December 9, 2003 08:57  Type: N  Check: 1141  ..

       1  atggacgata ctagcggaca aactttcatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagcactg aagtcaaaac cgtaagtttg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttattatcga cgctttgata
     151  cggaaaacta gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaagt caacaacaca caatctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtgaaata tttaaataaa agagaagcta gagctttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcatacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaggaagct ccggaacatt ataagttcgg
     501  tatgactgct aaggcaatgt taccgaacat caacgctata gacgttggtg
     551  ataacgaaga cacttcgtcg gaatacccag tgagtctgag tgtttcaggc
     601  ggagttctcc gtgaacacca cttcatctga tt