Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone 305-23-16

ACC No: AJ579776

Dated: 2003-12-04 | Length: 632 | CRC: 2053178777

                !!NA_SEQUENCE 1.0
ID   CTR579776  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579776;
XX
SV   AJ579776.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone 305-23-16
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6D4; Q7T6D4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="Spain"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="305-23-16"
FT                   /isolate="T-305"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6D4"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30358.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 632 BP; 195 A; 126 C; 157 G; 154 T; 0 other;

AJ579776  Length: 632  December 9, 2003 08:57  Type: N  Check: 7643  ..

       1  atggacgata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagtactg aaatcaaaac cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata gttatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgaga actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatgactgcc aaggcaatgt taccggacat caacgctgta gacgttggcg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga tt