Sequence of DPV Carnation mottle virus

Carnation mottle virus p9 gene for movement protein

ACC No: AJ584842

Dated: 2003-10-10 | Length: 255 | CRC: -39925573

                !!NA_SEQUENCE 1.0
ID   AJ584842   standard; genomic RNA; VRL; 255 BP.
XX
AC   AJ584842;
XX
SV   AJ584842.1
XX
DT   10-OCT-2003 (Rel. 77, Created)
DT   10-OCT-2003 (Rel. 77, Last updated, Version 1)
XX
DE   Carnation mottle virus p9 gene for movement protein
XX
KW   movement protein; p9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-255
RA   Sherpa A.R.;
RT   ;
RL   Submitted (05-OCT-2003) to the EMBL/GenBank/DDBJ databases.
RL   Sherpa A.R., Plant Virus Lab, Floriculture Division, Inst. of Himalayan
RL   Bioresource Technology, IHBT, P.B # 6, Palampur, Himachal Pradesh, 176061,
RL   INDIA.
XX
RN   [2]
RA   Mishra M., Sherpa A.R., hallan V.K., Zaidi A.A.;
RT   "Cloning and sequencing of movement protein genes (p7 & p9) of Indian
RT   Isolate of Carnation mottle virus";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .255
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /lab_host="Saponaria"
FT                   /specific_host="Carnation"
FT   CDS             1. .255
FT                   /gene="p9"
FT                   /product="movement protein"
FT                   /protein_id="CAE51188.1"
FT                   /translation="MPSANLHLIVLTGEIGLMLLIRINCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISVSTPNGK"
XX
SQ   Sequence 255 BP; 82 A; 51 C; 45 G; 77 T; 0 other;

AJ584842  Length: 255  October 21, 2003 08:55  Type: N  Check: 7649  ..

       1  atgccatccg caaacctgca tctgatagta ctaacggggg aaattgggtt
      51  aatgttgctg ataagaataa attgcacatt cacttcaact tttagtttgc
     101  ccccactggt aactctaaat cagataatag cgttgtcatt ttgtggtctt
     151  ctattaaaca gcatctctcg ggcagaaaga gcttgctatt acaattactc
     201  tgttgatagt tctaaacaac aacacatttc ggtaagtaca ccaaatggaa
     251  aataa