Sequence of DPV Carnation mottle virus

Carnation mottle virus p7 gene for movement protein

ACC No: AJ584843

Dated: 2003-10-10 | Length: 186 | CRC: 2130051261

                !!NA_SEQUENCE 1.0
ID   AJ584843   standard; genomic RNA; VRL; 186 BP.
XX
AC   AJ584843;
XX
SV   AJ584843.1
XX
DT   10-OCT-2003 (Rel. 77, Created)
DT   10-OCT-2003 (Rel. 77, Last updated, Version 1)
XX
DE   Carnation mottle virus p7 gene for movement protein
XX
KW   movement protein; p7 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-186
RA   Sherpa A.R.;
RT   ;
RL   Submitted (05-OCT-2003) to the EMBL/GenBank/DDBJ databases.
RL   Sherpa A.R., Plant Virus Lab, Floriculture Division, Inst. of Himalayan
RL   Bioresource Technology, IHBT, P.B # 6, Palampur, Himachal Pradesh, 176061,
RL   INDIA.
XX
RN   [2]
RA   Mishra M., Sherpa A.R., Hallan V.K., Zaidi A.A.;
RT   "Cloning and sequencing of movement protein genes (p7 & p9) of Indian
RT   Isolate of Carnation mottle virus";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .186
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /lab_host="Saponaria"
FT                   /specific_host="Carnation"
FT   CDS             1. .186
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="CAE51189.1"
FT                   /translation="MDIESEVPVIEKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
XX
SQ   Sequence 186 BP; 63 A; 31 C; 47 G; 45 T; 0 other;

AJ584843  Length: 186  October 21, 2003 08:55  Type: N  Check: 3372  ..

       1  atggatattg aatcggaagt accagtaatt gaaaagcaaa tgctcgctgg
      51  gaatagagga aaacaaaaga cacgtagatc ggtggccaaa gatgccatcc
     101  gcaaacctgc atctgatagt actaacgggg gtaattgggt taatgttgct
     151  gataagattg aggtgcacat tcacttcaac ttttag