Sequence of DPV Pelargonium necrotic spot virus

Pelargonium necrotic spot virus complete genome, genomic RNA

ACC No: AJ607402

Dated: 2009-07-28 | Length: 4744 | CRC: 691648634

                
ID   AJ607402; SV 1; linear; genomic RNA; STD; VRL; 4744 BP.
XX
AC   AJ607402;
XX
DT   20-NOV-2003 (Rel. 77, Created)
DT   28-JUL-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Pelargonium necrotic spot virus complete genome, genomic RNA
XX
KW   coat protein; complete genome; cp gene; gene silencing suppressor;
KW   movement protein; p19 protein; p21 protein; p36 protein; p40 protein ;
KW   p95 protein; readthrough protein,; rep gene; replicase.
XX
OS   Pelargonium necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4744
RA   Heinze C.;
RT   ;
RL   Submitted (17-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL   Heinze C., Dept. Phytomedizin, Institut fuer Angewandte Botanik,
RL   Ohnhorststrasse 18, Hamburg 22609, Germany.
XX
RN   [2]
RA   Heinze C., Wobbe V., Lesemann D.E., Zhang D.Y., Willingmann P., Adam G.;
RT   "Pelargonium necrotic spot virus: a new member of the genus Tombus virus";
RL   Arch. Virol. 149(8):1527-1539(2004).
XX
DR   RFAM; RF00510; Tombus_IRE.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4744
FT                   /organism="Pelargonium necrotic spot virus"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:255587"
FT   CDS             77. .2635
FT                   /transl_except=(pos:1067. .1069,aa:OTHER)
FT                   /gene="rep"
FT                   /product="putative replicase, p95"
FT                   /note="readthrough stop codon"
FT                   /db_xref="GOA:Q709N2"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q709N2"
FT                   /protein_id="CAE55156.1"
FT                   /translation="MEGLKAESTTTVGINCNFQQTVMTETGDKLMFGSLPSVLNRPVAR
FT                   RNYYRTLSNWVLTYTKTGKIEDTHDNAGSYVEDLVKTDFNAKYDWLAKRGVAREYRTAV
FT                   GLAIIPSIPAIVANTRIVTGTCEVARVAVKLPKVLNILTRFTHVSVKVPYFYPRVDISA
FT                   RGVLIGLAAAAALVPICAGIAYATLPREKLSVFRLKTEVRVHMEDEKEATDLLLVEPAR
FT                   ELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAKIAQVARAKVGYLKNSPENRLIYQRV
FT                   MIEIMDKDCVRYVDRDVILPLAIGCCFVYPEGVEESAALWGSQESLGVKXGGLVRLPGV
FT                   VTQINRDIPSDVLLPQEVLEVRVGPPNAKNRNIFMVAGCPSQARFLVHNHCLKNLKRGL
FT                   VERAFCVERNGKLARTPQPTKGAFGRLSPFRKAVCEKVGVAHRLGYDGFLSYYSGAKLR
FT                   TYTRAVESLHITPVSERDSHLTTFVKAEKISTSKNDPAPRVIQPRNPRYNVELGRYLRH
FT                   MESKLMKAVDGVFGETTCIKGYTADEVGAIFRAKWDRFDKPVAIGLDASRFDQHCSVEA
FT                   LQYEHSFYRALYPGNKLLGKLLEWQLHNKGKGYVPDGTITYRKEGCRMSGDINTSLGNY
FT                   LLMCAMIHGYMRHLGINEFSLANCGDDCVLILERRNLKQAQKTLPEYFLNLGYTMKVEQ
FT                   PVFQLEAVEFCQAHPVQFQGGWKMVRNVRTAMSKDVHCVNNIRDLATRRAWSNAQHHGG
FT                   LALSAGIPVVEKFYSRFTLYDVPKKHQRIDTVTNVHKWRGSGGSYVVTPESRASFWAAF
FT                   GLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSILDSAVA"
FT   CDS             77. .1069
FT                   /gene="rep"
FT                   /product="putative replicase, p36"
FT                   /db_xref="GOA:Q709N1"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q709N1"
FT                   /protein_id="CAE55157.1"
FT                   /translation="MEGLKAESTTTVGINCNFQQTVMTETGDKLMFGSLPSVLNRPVAR
FT                   RNYYRTLSNWVLTYTKTGKIEDTHDNAGSYVEDLVKTDFNAKYDWLAKRGVAREYRTAV
FT                   GLAIIPSIPAIVANTRIVTGTCEVARVAVKLPKVLNILTRFTHVSVKVPYFYPRVDISA
FT                   RGVLIGLAAAAALVPICAGIAYATLPREKLSVFRLKTEVRVHMEDEKEATDLLLVEPAR
FT                   ELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAKIAQVARAKVGYLKNSPENRLIYQRV
FT                   MIEIMDKDCVRYVDRDVILPLAIGCCFVYPEGVEESAALWGSQESLGVK"
FT   CDS             2650. .3786
FT                   /gene="cp"
FT                   /product="coat protein, p40"
FT                   /db_xref="GOA:Q709N5"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q709N5"
FT                   /protein_id="CAE55158.1"
FT                   /translation="MALVRRNNNSNMVAVPAARATGAAIGSMMFSPTGAKLFWTGMDWV
FT                   LDKTWQKIKNQFKSRKTDMILHPGAYPGAIAAPVAVTRVIRGSKPKFTRSKGAVTITHR
FT                   ELVGQYNNSAGLVVNGSVGGTIYKLNPSNALLFPWLQSIASNFDQYKFDNVKLTYIPMC
FT                   ATTETGRVALYFDKDSQDPVPADRMELANMFHLRETAPWAESNLNVPTDNVKRFTNDNT
FT                   TTDLKLVDLGQIGIATFGGSGTNPVGDLFIHYTVTFFEPQPSAGIVETEQTGAGALDSG
FT                   PDMVSVGGDAISTLIVFKTPGTFILTLDSVIPPWGLLVPTGVTVNSSTHAQATGFCQSI
FT                   VNLTVSTPGGILQYNGTGFGNRTVNIVRAKVTNRVDII"
FT   CDS             3823. .4392
FT                   /product="movement protein, p21"
FT                   /db_xref="GOA:Q709N4"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProtKB/TrEMBL:Q709N4"
FT                   /protein_id="CAE55159.1"
FT                   /translation="MDTEYEQVNKPWNELYKEATLGNKLTVNVGMEDVEVPLLPSNFLT
FT                   KVRVSMSGGYITVRRVRIKIIPLVSRKAGVSGKLYLRDISDTAGRKLHCTELLDLGKEI
FT                   RLTMQHLDFSVSAKSDVPIVFGFEDLVSPYLEGRELFSVSLRWQFGLSAQCYSLPPAKW
FT                   KVMYQEEALKALKPSKKKASKTDSSV"
FT   CDS             3855. .4373
FT                   /product="p19"
FT                   /function="putative gene silencing suppressor"
FT                   /db_xref="GOA:Q709N3"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q709N3"
FT                   /protein_id="CAE55160.1"
FT                   /translation="MERAVQGGDAREQANSERWDGGCGGTITPFKLSDESPSLHEWRLH
FT                   HSEEGEDQDHPLGFKESWSFGKVVFKRYLRYGGTETSLHRALGSWERNTVNNAASRFLG
FT                   FGQIGCTYSIRFRGSCLTISGGSRTLQRLIEMAIRTKCTVLQLTPSEVEGNVSGGSPEG
FT                   IEAFEKESE"
XX
SQ   Sequence 4744 BP; 1243 A; 999 C; 1310 G; 1192 T; 0 other;

aj607402 Length: 4744  28-JUL-2009  Type: N  Check: 9450  ..

       1  agaaatacct caggacctga ccgtccggtg agttgcgctt atcccttgcg
      51  taaggtattt ctctctcctt gttaatatgg agggtttgaa ggctgagtct
     101  accacaactg tggggataaa ttgtaacttc cagcaaacag tgatgactga
     151  gaccggtgat aagttgatgt tcggaagttt accttcagtt ttgaatcgac
     201  ctgttgcaag gaggaactat tatcgtacat tatcgaactg ggttttgacg
     251  tacactaaga cagggaaaat agaggataca catgataatg ctgggagtta
     301  tgtcgaggat ctcgtcaaga ctgacttcaa tgctaaatat gactggttgg
     351  ctaagcgtgg tgtggctcgt gagtatcgca ctgccgtggg gttggccatc
     401  atacctagta tcccggcgat tgtggcaaac acacgcattg ttactggtac
     451  atgtgaggta gcgagggttg ctgtaaagct gcccaaggtt ctgaacattc
     501  tcaccagatt cacacatgtg agtgttaagg taccgtactt ttatccacgt
     551  gtggacataa gtgcgcgtgg cgtgctcatt ggcctggcgg cggctgcagc
     601  acttgttcct atttgtgctg gcatagcgta cgctaccctc cccagggaaa
     651  aactgtctgt gtttaggttg aagacagagg ttcgtgttca tatggaggat
     701  gagaaagaag caacagactt gttgttggtt gagcccgctc gggagctcaa
     751  gggtaaggat ggtgaggatc tcctcactgg tagcagatta actaaggtga
     801  tcgcgtccac ggggcgccct cgcagaaggc cttatgcagc taaaattgca
     851  caggtcgcga gagctaaggt gggctatctt aagaacagtc ctgaaaatag
     901  actaatctac cagcgagtga tgattgagat catggacaag gactgcgtca
     951  ggtatgttga cagggatgtc atattgcctt tggctattgg atgctgtttt
    1001  gtctatccgg aaggagtgga agagtcggcg gcactatggg gttcccagga
    1051  atcccttggt gtcaaatagg gaggcctagt gcgtctacct ggggtcgtaa
    1101  cacagatcaa tcgagatatc ccatctgatg tgttacttcc ccaggaagtg
    1151  ctagaggttc gtgtaggacc tcccaatgct aagaaccgta acatatttat
    1201  ggttgcaggt tgcccatcac aggcacggtt cttagtgcat aatcactgcc
    1251  tgaaaaacct caaaaggggt cttgtggaga gagccttctg cgtagagaga
    1301  aacgggaagc tcgctcgcac tccacaacct accaaaggag cttttggacg
    1351  tctttccccg ttcaggaaag cagtctgtga gaaggttggg gtggcccacc
    1401  gacttgggta tgatggattt ctgtcatact acagcggtgc gaaactccgt
    1451  acttacacac gggctgtgga gagtctgcat atcactcctg tctcggagag
    1501  ggatagtcat ttgactacct tcgtcaaggc ggagaagata tcgacgtcca
    1551  aaaatgaccc agcacctcgg gtgattcagc ctcgaaaccc gaggtacaat
    1601  gtggaacttg gaagatatct acggcatatg gaatccaagc taatgaaagc
    1651  tgtcgatggc gtgttcggag agacaacatg catcaaagga tatacggctg
    1701  atgaggtggg tgcaatcttt cgggctaagt gggacaggtt tgataaacct
    1751  gtggccatag ggctcgatgc atccaggttt gatcaacact gttccgtgga
    1801  ggctttgcaa tatgaacata gcttctacag ggccttgtac cctggcaaca
    1851  agctcctggg caagttgttg gaatggcagc tccataacaa aggcaaaggt
    1901  tatgtccctg atgggactat aacctatcgc aaggagggct gccgcatgag
    1951  tggggacatc aacacctcat tggggaacta tctattgatg tgtgcaatga
    2001  tacacgggta catgcgccat ttgggaatta atgaatttag tctggctaac
    2051  tgtggggatg actgtgttct tatcttagaa cgtagaaatc ttaagcaggc
    2101  acagaaaact ctgcctgagt atttcctaaa cttaggatac actatgaagg
    2151  ttgagcaacc tgtattccaa ttggaagcgg ttgagttttg ccaggcacac
    2201  ccagtacagt ttcaaggtgg ttggaagatg gtccggaatg tccgcaccgc
    2251  tatgagcaag gatgtacact gtgtcaataa tatacgggat ttggcaacga
    2301  ggagggcttg gagtaatgca caacaccatg gtggactggc actgagtgct
    2351  ggaatacctg tggtagagaa gttttactct agattcacct tgtatgatgt
    2401  gcccaagaaa catcagcgta tagacacagt gactaatgtg cacaagtggc
    2451  gtggatcggg tggtagctat gttgtgaccc ctgaatccag agcgagcttt
    2501  tgggccgctt ttggactcac gggggatgag cagctggctc ttgaggaccg
    2551  tctggacaga tgggagatgg atctatttgg agaggagggt gttgacgctc
    2601  atgagcccag catccttgac tccgccgtgg cttgaccaag taaacacaaa
    2651  tggcgctagt gagaagaaac aacaactcaa atatggtggc tgtgccagca
    2701  gccagggcca ccggtgcagc aatcgggtct atgatgttca gtcccactgg
    2751  ggctaagtta ttctggacag gtatggactg ggtgctagat aagacatggc
    2801  agaagataaa gaaccaattc aagagtagga agacagacat gattctacac
    2851  cctggggctt acccaggggc tattgcagcc cctgtggcag tcactagggt
    2901  catcagaggt agtaaaccaa aattcacgcg gagtaaggga gccgttacaa
    2951  tcactcatcg tgagttggtt gggcaataca ataactccgc gggtctggta
    3001  gtcaatgggt cagtgggcgg gacgatttac aaacttaatc catctaacgc
    3051  tttgttattc ccgtggttac aatctatagc ctcaaacttt gatcagtaca
    3101  aatttgataa tgtaaagttg acatatatac caatgtgtgc cacaactgaa
    3151  actggcaggg tagccttgta tttcgataag gactcacaag accctgttcc
    3201  agcggataga atggagttgg ccaacatgtt tcacttgcgc gagacagccc
    3251  cttgggctga atccaattta aatgtaccta ctgataatgt taagaggttt
    3301  acgaatgaca acacgactac cgatttgaag ttggtggact tggggcagat
    3351  agggatagcg acttttggag gtagtggtac caaccccgtt ggggatttgt
    3401  tcatccacta tactgtcact ttctttgagc ctcaaccctc ggcggggatt
    3451  gtggaaactg agcaaacagg agccggtgca ctagatagtg gaccagatat
    3501  ggtgagtgtt ggtggtgacg ccatctccac cttgatagtg tttaaaactc
    3551  ccggcacctt catccttact cttgacagcg taataccacc ctggggactg
    3601  cttgtaccca ctggtgtgac ggttaattct tctacacatg cgcaagcaac
    3651  cggattctgc cagtcaatcg tcaatttgac cgtgagcaca cctggtggta
    3701  tcctgcagta caatggcact ggatttggta ataggacggt gaatatcgta
    3751  cgtgccaagg tcaccaatcg tgttgatatc atttagcgtc atgttagggg
    3801  cctcttgaag ttagaccaat tcatggatac tgaatacgaa caagtcaata
    3851  aaccatggaa cgagctgtac aaggaggcga cgctagggaa caagctaaca
    3901  gtgaacgttg ggatggagga tgtggaggta ccattactcc cttcaaactt
    3951  tctgacgaaa gtccgagtct ccatgagtgg aggttacatc acagtgagga
    4001  gggtgaggat caagatcatc cccttggttt caaggaaagc tggagtttcg
    4051  ggaaagttgt atttaagaga tatctcagat acggcgggac ggaaacttca
    4101  ttgcacagag ctcttggatc ttgggaaaga aatacggtta acaatgcagc
    4151  atctagattt ctcggtttcg gccaaatcgg atgtacctat agtattcggt
    4201  ttcgaggatc ttgtctcacc atatctggag ggtcgcgaac tcttcagcgt
    4251  ctcattgaga tggcaattcg gactaagtgc acagtgttac agcttacccc
    4301  cagcgaagtg gaaggtaatg tatcaggagg aagccctgaa ggcattgaag
    4351  ccttcgaaaa agaaagcgag taagacagac tcttcagtct gatgttacgg
    4401  agatgagtag aacaaagtga gggactatgg gttacccttt gtagatttgg
    4451  tccgcatgat gacgagttag gtcaggcccc gcgccaggtt tggtcacctg
    4501  ggggatgggg acacggaaag gatctcgcat gctgttagtc tgacgaaagt
    4551  cgagcttgca atgtgggtct atgcctaaat aagtcgtgtg ggttgccgcc
    4601  tacaaggaat tggatgccac ttttctctca gtgagctctc tcattgaagt
    4651  agcattagac acggttgatc tcacccttcg ggggggctat agagatcgct
    4701  ggaagcacta ccggacaaac cggaacattg cagaaattca gccc