Sequence of DPV Carnation mottle virus

Carnation mottle virus complete genome, isolate Indian

ACC No: AJ811998

Dated: 2004-09-08 | Length: 4005 | CRC: 1641473180

                !!NA_SEQUENCE 1.0
ID   AJ811998   standard; genomic RNA; VRL; 4005 BP.
XX
AC   AJ811998;
XX
SV   AJ811998.1
XX
DT   08-SEP-2004 (Rel. 81, Created)
DT   08-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Carnation mottle virus complete genome, isolate Indian
XX
KW   coat protein; complete genome; CP gene; gp1 gene; gp2 gene; gp3 gene;
KW   movement protein P7; movement protein P9; p7 gene; p9 gene;
KW   polymerase associated protein; polymerase associated protein GP1;
KW   polymerase associated protein GP2; polymerase associated protein GP3.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4005
RA   Raikhy G.;
RT   ;
RL   Submitted (27-AUG-2004) to the EMBL/GenBank/DDBJ databases.
RL   Raikhy G., Floriculture Division, Institute of Himalayan Bioresource Tech.,
RL   PO Box # 6, Palampur, Distt. Kangra, Himachal Pradesh, INDIA.
XX
RN   [2]
RA   Raikhy G., Hallan V., Kulshrestha S., Verma R.R., Zaidi A.A.;
RT   "Complete nucleotide sequence of an Indian isolate of Carnation mottle
RT   virus";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4005
FT                   /country="India:Northern Himalayan Region, Palampur"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /isolate="Indian"
FT                   /lab_host="Dianthus barbatus"
FT                   /specific_host="Dianthus caryophyllus (clove pink)"
FT   CDS             69. .806
FT                   /gene="gp3"
FT                   /product="polymerase associated protein GP3"
FT                   /protein_id="CAH25506.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GVRRIVSSGGKCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFIRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGRKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEAWCVVNGFDSNKPVTFPK"
FT   CDS             69. .2363
FT                   /transl_except=(pos:804. .806,aa:OTHER)
FT                   /gene="gp2"
FT                   /product="polymerase associated protein GP2"
FT                   /protein_id="CAH25507.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GVRRIVSSGGKCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFIRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGRKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEAWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPPRERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKEQVSCPQPEPGSFNVTGNLRRR
FT                   FHRVCGNHSRNSANDLVDCYQGRKRTIYDENAAASLLDRAIERKDGDLKTFIKAEKFNV
FT                   NLKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHI
FT                   WSAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGV
FT                   GFASNGMLRYTKEGCRMSGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERT
FT                   DIDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKD
FT                   SHSLVHWNNEKNAKQWLKSVGMCGLRIAGGVPVVQEFYQKYVETAGNVKENKNITEKSS
FT                   SGFFMMADRAKRGYSAVSEVCRFSFYQAFGITPDQQIALEGEIRSLTINTNVGPQCEAA
FT                   DSLWILNRKYQ"
FT   CDS             69. .2681
FT                   /transl_except=(pos:804. .806,aa:OTHER)
FT                   /transl_except=(pos:2361. .2363,aa:OTHER)
FT                   /gene="gp1"
FT                   /product="polymerase associated protein GP1"
FT                   /protein_id="CAH25508.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GVRRIVSSGGKCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFIRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGRKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEAWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPPRERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKEQVSCPQPEPGSFNVTGNLRRR
FT                   FHRVCGNHSRNSANDLVDCYQGRKRTIYDENAAASLLDRAIERKDGDLKTFIKAEKFNV
FT                   NLKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHI
FT                   WSAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGV
FT                   GFASNGMLRYTKEGCRMSGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERT
FT                   DIDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKD
FT                   SHSLVHWNNEKNAKQWLKSVGMCGLRIAGGVPVVQEFYQKYVETAGNVKENKNITEKSS
FT                   SGFFMMADRAKRGYSAVSEVCRFSFYQAFGITPDQQIALEGEIRSLTINTNVGPQCEAA
FT                   DSLWILNRKYQXLESKCSLGIEENKRRVDRWPRMPSVNLHLIVLTGVFGLMLLIRLRCT
FT                   FTSTFSLPPLVTLNQIIALSFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             2336. .2521
FT                   /gene="p7"
FT                   /product="movement protein P7"
FT                   /protein_id="CAH25509.1"
FT                   /translation="MDIEPEVPVAGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGI
FT                   WVNVADKIEVHIHFNF"
FT   CDS             2427. .2681
FT                   /gene="p9"
FT                   /product="movement protein P9"
FT                   /protein_id="CAH25510.1"
FT                   /translation="MPSVNLHLIVLTGVFGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             2671. .3717
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAH25511.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKYLTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQILKITKTTAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 4005 BP; 1127 A; 872 C; 1094 G; 912 T; 0 other;

AJ811998  Length: 4005  September 14, 2004 08:39  Type: N  Check: 1459  ..

       1  gggtaagctg gcgggcaaac ctacctctat cttaattaca ttatatattc
      51  taaccatctg ctttcactat gggattaccc agtctactag tggaaggcgt
     101  tattggatgc actctagtcg gtggtttggt ggctgtgggt agcgcagcgc
     151  tggccgttcg ggcgaccatc ggtgttgtag aattcaatag ggagtgtgtg
     201  cgcggggtga gaaggatcgt atctagcgga ggaaagtgct taatagtcca
     251  atccccttat ggtaatccta accaaggatt gataaggggt gaagacgaag
     301  aaattgacaa tgtggaggag tcaacaccgg aggaattgac tcagttgatt
     351  gaggttaagg cggaagtgga tgggaaagag gtcgtcgtct ccaagaagcg
     401  tgtagtaaac aggcacttga gacaacgatt cattcgctcc atagccatcg
     451  aagccaaaaa tcactttggt ggtgacatca gccctagcaa ggccaactac
     501  ctttccgttt ccaagtttct gacggggaaa tgcaaggaga gacatgttgt
     551  gcccgctcac actagagatt gtgtgagtgc tgctatggtg ctggtattca
     601  cccccgacgt ccacgagatc aggatgatgg caggattggc gtccgacgca
     651  gcgtacggaa gaaagatcgc aatggcgagc atactgaaca ggaaagggtg
     701  gtgttggagg ttaatggtaa atccattgga tagggcaaga tggtgggaag
     751  cgtggtgcgt tgtaaacggg tttgactcca acaaacccgt cacctttccc
     801  aaataggggg gcctgttcta cctcaatggt gtggagacga agattcgtcg
     851  tggaggccac ccatcagtga ttgaggtaga cgggcaatgt cctcccagag
     901  agagaaaact ctacgtacag aatgccataa ccactggtta tgaatacagg
     951  gtccacaacc attcgtacgc aaacctcaga cgagggctcc ttgagagagt
    1001  tttctatgtt gagcgcaaca aggagcaagt cagctgtccg caacctgaac
    1051  ccggcagctt taatgtgacg ggaaacctgc gacgcaggtt ccatagagtg
    1101  tgtggtaatc attcccggaa ctctgccaac gatttggtag attgttacca
    1151  gggcaggaaa cgcacaatct atgatgagaa tgcagcggcg tctctacttg
    1201  atagagctat cgaaaggaag gatggcgatc tcaaaacctt tatcaaggcg
    1251  gagaaattca acgtaaatct gaaaagtgat cctgctcctc gggttataca
    1301  acctaggagc cctcgctaca acgtggagtt gggccggtac ttaaagaagt
    1351  atgaacacca tgcttacaaa gccttagaca agatctgggg aggaccaaca
    1401  gtcatgaaag gatacactac agaggaggta gcacagcaca tttggagcgc
    1451  atggaatcaa ttccagacac ctgtagccat aggatttgac atgtcaagat
    1501  tcgatcagca tgtgtctgta gccgcgctcg agttcgaaca ttcatgctat
    1551  ttggcctgtt ttgaagggga cgctcatctc gccaacttgc ttaagatgca
    1601  actggtgaat catggcgtgg gttttgctag caatggaatg ttgcgataca
    1651  caaaggaagg gtgcagaatg agcggtgaca tgaacactgc cttgggcaac
    1701  tgtttgttag cttgccttat caccaaacac ttaatgaaaa tcaggagcag
    1751  actgatcaac aatggggatg actgcgtgct tatttgcgaa agaacagaca
    1801  tcgactacgt cgtgagtaat ttaacgacgg gatggagtcg atttggattc
    1851  aattgcatag cagaagagcc agtgtacgaa atggaaaaga tcaggttctg
    1901  ccagatggca ccggtgtttg atggagcagg ttggctgatg gtcagggacc
    1951  ccttggtgag catgagcaag gattctcact ccttagtgca ttggaacaac
    2001  gaaaagaatg caaaacaatg gctgaagtca gtaggaatgt gcggtctgcg
    2051  gattgccggg ggggttccag ttgtgcaaga gttctaccag aaatacgttg
    2101  aaacagccgg gaatgtgaaa gagaacaaaa atatcacaga gaagagtagt
    2151  tctgggttct ttatgatggc ggatcgcgct aagcggggct attctgctgt
    2201  gtctgaggtg tgccgattta gcttctacca ggcattcggc atcacgccag
    2251  accagcagat cgcgttggag ggggagatca ggtctctcac tatcaacacc
    2301  aacgtggggc cccagtgtga agcggcagat tcactatgga tattgaaccg
    2351  gaagtaccag tagctggaaa gcaaatgctc gctgggaata gaggaaaaca
    2401  aaagacgcgt agatcggtgg ccaaggatgc catccgtaaa cctgcatctg
    2451  atagtactaa cgggggtatt tgggttaatg ttgctgataa gattgaggtg
    2501  cacattcact tcaactttta gtttgccccc actggtaact ctaaatcaga
    2551  taatagcgtt gtcattttgt ggtcttctat taaacagcat ctctcgggca
    2601  gaaagagctt gctattacaa ctactctgtt gatagttcca aacaacaaca
    2651  catttcgata agtacaccaa atggaaaata aaggagaaaa gatcgcgatg
    2701  aatcccactg tgcaaacatt ggcgcagaag ggggacaagt tagccgtgaa
    2751  gttggtgaca agagggtggg cctctctgag tacgaaccag aagaggagag
    2801  ctgaaatgct tgctggatac actccagcga tcctagcctt cacaccccga
    2851  cgaccacgga tgacgaaccc tcctccaaga accagtagga attcaccagg
    2901  acaagctgga aagtacctga cgatgagtaa gaccgaacta ctaagcaccg
    2951  tcaaaggtac cacgggtgtt atcccaagct ttgaagactg ggtcgtttcc
    3001  ccccgaaacg tagccgtctt cccacaactc tcgctgctgg cgacgaactt
    3051  caacaagtac cgcattactg cgctcactgt gaagtactca cccgcgtgca
    3101  gcttcgagac caatgggagg gtggctctgg gattcaacga tgacgcttcg
    3151  gacacaccgc caaccaccaa ggttggattt tacgatctgg gcaaacatgt
    3201  ggaaactgct gcacagacag ctaaggatct agtgatacca gtagacggca
    3251  aaacccggtt catcagggac tcggctagtg atgatgccaa actagtcgat
    3301  tttggacgaa tagtcttgtc aacatacggg tttgacaagg ctgacactgt
    3351  ggtgggcgaa ttgttcatac agtacacgat tgtgctgagt gacccaacca
    3401  agacggccaa aatttcacag gcaagcaacg ataaggtgtc ggacggacca
    3451  acgtatgtgg tcccttcggt taatggcaac gagctacagc taagagtggt
    3501  agccgctggg aaatggtgca ttatagtgcg gggtacggtt gagggaggct
    3551  tcaccaaacc cacacttgtt ggaccgggaa tcagcggtga tgtggactat
    3601  gaaagtgcca gacctatcgc catttgtgaa ttggtgacac aaatggaggg
    3651  ccagatattg aaaatcacca agaccacagc agaacaacca ctccaatggg
    3701  ttgtttatag gatgtgaacg caatagaaaa gtttgttaga cacacacggc
    3751  gggacgtgtt gccggagctg ccactccgcc caagatggat cgatattaac
    3801  catctttggc aacagcgtgc gtgactaatc gaacctagta attgcatagc
    3851  atccgactat aacctgttct ctgctggata cgagggtggc ctcgtgatcc
    3901  caaaccataa aagaaaccaa cttgttggtg gaagggcttg gaagtaggat
    3951  caaccactgt ttattaatta ggggtgagag tattcactgt actctttccc
    4001  cgccc