Sequence of DPV Carnation mottle virus

Carnation mottle virus p9 gene for Movement protein p9, genomic RNA, isolate Solan

ACC No: AJ844553

Dated: 2004-10-05 | Length: 255 | CRC: -1774680632

                !!NA_SEQUENCE 1.0
ID   AJ844553   standard; genomic RNA; VRL; 255 BP.
XX
AC   AJ844553;
XX
SV   AJ844553.1
XX
DT   05-OCT-2004 (Rel. 81, Created)
DT   05-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Carnation mottle virus p9 gene for Movement protein p9, genomic RNA,
DE   isolate Solan
XX
KW   Movement protein p9; p9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-255
RA   Raikhy G.;
RT   ;
RL   Submitted (04-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan
RL   Bioresource Tech., PO Box # 6, Palampur, Distt. Kangra, Himachal Pradesh
RL   176 061, INDIA.
XX
RN   [2]
RA   Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.;
RT   "Variability studies of different Carnation mottle virus strains infecting
RT   carnations in India";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .255
FT                   /country="India:Northern Himalayan Region, Solan"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /isolate="Solan"
FT                   /specific_host="Dianthus caryophyllus"
FT   CDS             1. .255
FT                   /gene="p9"
FT                   /product="Movement protein p9"
FT                   /protein_id="CAH59637.1"
FT                   /translation="MPSVNLHLIVLTGVFGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
XX
SQ   Sequence 255 BP; 78 A; 52 C; 47 G; 78 T; 0 other;

AJ844553  Length: 255  October 12, 2004 08:59  Type: N  Check: 8437  ..

       1  atgccatccg taaacctgca tctgatagta ctaacggggg tatttgggtt
      51  aatgttgctg ataagattga ggtgcacatt cacttcaact tttagtttgc
     101  ccccactggt aactctaaat cagataatag cgttgtcatt ttgtggtctt
     151  ctattaaaca gcatctctcg ggcagaaaga gcttgctatt acaactactc
     201  tgttgatagt tccaaacaac aacacatttc gataagtaca ccaaatggaa
     251  aataa