Sequence of DPV Carnation mottle virus
Carnation mottle virus p7 gene for Movement protein p7, genomic RNA, clone 392
ACC No: AJ844587
Dated: 2004-10-05 | Length: 186 | CRC: -1075361337
!!NA_SEQUENCE 1.0 ID AJ844587 standard; genomic RNA; VRL; 186 BP. XX AC AJ844587; XX SV AJ844587.1 XX DT 05-OCT-2004 (Rel. 81, Created) DT 05-OCT-2004 (Rel. 81, Last updated, Version 1) XX DE Carnation mottle virus p7 gene for Movement protein p7, genomic RNA, clone DE 392 XX KW Movement protein p7; p7 gene. XX OS Carnation mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae; OC Carmovirus. XX RN [1] RP 1-186 RA Raikhy G.; RT ; RL Submitted (04-OCT-2004) to the EMBL/GenBank/DDBJ databases. RL Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan RL Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.; RT "Variability studies of movement protein and coat protein genes of RT different Carnation mottle virus Indian strains"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1. .186 FT /country="India:Northern Himalayan Region, Palampur" FT /db_xref="taxon:11986" FT /mol_type="genomic RNA" FT /virion FT /organism="Carnation mottle virus" FT /clone="392" FT /isolate="Palampur" FT /lab_host="Dianthus barbatus" FT /specific_host="Dianthus caryophyllus" FT CDS 1. .186 FT /gene="p7" FT /product="Movement protein p7" FT /protein_id="CAH59643.1" FT /translation="MDIEPEVPVAGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN FT WVNVADKSEVHIHFNF" XX SQ Sequence 186 BP; 60 A; 32 C; 51 G; 43 T; 0 other; AJ844587 Length: 186 October 12, 2004 08:59 Type: N Check: 3409 .. 1 atggatattg aaccggaagt accagtagct ggaaagcaaa tgctcgctgg 51 gaatagagga aaacaaaaga cacgtagatc ggtggccaag gatgccatcc 101 gtaaacctgc atctgatagt actaacgggg gtaattgggt taatgttgct 151 gataagagtg aggtgcacat tcacttcaac ttttag