Sequence of DPV Carnation mottle virus

Carnation mottle virus p7 gene for Movement protein p7, genomic RNA, clone 392

ACC No: AJ844587

Dated: 2004-10-05 | Length: 186 | CRC: -1075361337

                !!NA_SEQUENCE 1.0
ID   AJ844587   standard; genomic RNA; VRL; 186 BP.
XX
AC   AJ844587;
XX
SV   AJ844587.1
XX
DT   05-OCT-2004 (Rel. 81, Created)
DT   05-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Carnation mottle virus p7 gene for Movement protein p7, genomic RNA, clone
DE   392
XX
KW   Movement protein p7; p7 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-186
RA   Raikhy G.;
RT   ;
RL   Submitted (04-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan
RL   Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA.
XX
RN   [2]
RA   Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.;
RT   "Variability studies of movement protein and coat protein genes of
RT   different Carnation mottle virus Indian strains";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .186
FT                   /country="India:Northern Himalayan Region, Palampur"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /clone="392"
FT                   /isolate="Palampur"
FT                   /lab_host="Dianthus barbatus"
FT                   /specific_host="Dianthus caryophyllus"
FT   CDS             1. .186
FT                   /gene="p7"
FT                   /product="Movement protein p7"
FT                   /protein_id="CAH59643.1"
FT                   /translation="MDIEPEVPVAGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKSEVHIHFNF"
XX
SQ   Sequence 186 BP; 60 A; 32 C; 51 G; 43 T; 0 other;

AJ844587  Length: 186  October 12, 2004 08:59  Type: N  Check: 3409  ..

       1  atggatattg aaccggaagt accagtagct ggaaagcaaa tgctcgctgg
      51  gaatagagga aaacaaaaga cacgtagatc ggtggccaag gatgccatcc
     101  gtaaacctgc atctgatagt actaacgggg gtaattgggt taatgttgct
     151  gataagagtg aggtgcacat tcacttcaac ttttag