Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate BF682
ACC No: AJ885093
Dated: 2005-06-23 | Length: 720 | CRC: 428738595
!!NA_SEQUENCE 1.0 ID AJ885093 standard; mRNA; VRL; 720 BP. XX AC AJ885093; XX SV AJ885093.1 XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate BF682 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the EMBL/GenBank/DDBJ databases. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 0:0-0(0). XX RN [3] RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX FH Key Location/Qualifiers FH FT source 1. .720 FT /country="Burkina Faso" FT /db_xref="taxon:31744" FT /mol_type="mRNA" FT /virion FT /organism="Rice yellow mottle virus" FT /isolate="BF682" FT CDS 1. .720 FT /evidence=EXPERIMENTAL FT /note="ORF4" FT /product="coat protein" FT /protein_id="CAI59640.1" FT /translation="MARKGKKVNSNQGQQGKRKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLY FT VIASMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 153 A; 199 C; 213 G; 155 T; 0 other; AJ885093 Length: 720 June 28, 2005 08:34 Type: N Check: 8264 .. 1 atggccagga agggcaagaa agtcaactcc aaccaggggc agcaaggaaa 51 gcggaagagc cggcgtccac gtggacgatc ggcggagccc cagcttcaac 101 gggctccagt ggctcaggcc tcccggatat ctgggacggt tcctggtcca 151 ctatcttcta acacctggcc gctccactcc gttgagttcc tagcggactt 201 caagcggagt tccacatcgg cggatgcgac gacatacgat tgtgtgccgt 251 ttaacctgcc tcgggtgtgg agtcttgctc gttgttactc catgtggaag 301 ccaacacggt gggatgtcgt ttacctccct gaggtgagcg ccacggtagc 351 tggaagtatc gagatgtgtt ttctctacga ctatgctgac accatcccaa 401 gtgacacggg caagatgagc aggacggcgg gcttcgtcac ctctagcgtt 451 tggtacggcg cggagggctg ccacttacta agtggtggct cagcacgaaa 501 tgccgtggtc gcctcgatgg actgttcccg agtcggctgg aaacgcgtta 551 ctagttccat acctagtagc gtggatccca acgtcgtaaa caccatactg 601 ccggctaggc tagccgtgcg atcgtcgatc aaaccgacgg ttagtgatac 651 gccggggaaa ctctacgtta tcgctagtat ggtcctgcgg gatccggttg 701 atccaacact caatacgtga