Sequence of DPV Citrus tristeza virus

Citrus tristeza virus gene for p27 protein, genomic RNA

ACC No: AM071488

Dated: 2005-08-08 | Length: 723 | CRC: 1142064052

                !!NA_SEQUENCE 1.0
ID   AM071488   standard; genomic RNA; VRL; 723 BP.
XX
AC   AM071488;
XX
SV   AM071488.1
XX
DT   08-AUG-2005 (Rel. 84, Created)
DT   08-AUG-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Citrus tristeza virus gene for p27 protein, genomic RNA
XX
KW   p27 gene; p27 protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Chiemsombat P.;
RT   ;
RL   Submitted (18-JUL-2005) to the EMBL/GenBank/DDBJ databases.
RL   Chiemsombat P., Plant Pathology, Kasetsart University, KamphaengSaen Camp,
RL   Malaiman Road, Kamphaeng Saen, Nakhon Pathom, THAILAND.
XX
RN   [2]
RA   Chiemsombat P., Larprom A., Setou W., Kusolputharag P.;
RT   "In vitro expression of citrus tristeza virus coat proteins and use of
RT   virus detection";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /country="Thailand:Kamphaeng Saen district"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="KPS27"
FT                   /isolation_source="leaf"
FT                   /specific_host="Citrus hystrix"
FT   CDS             1. .723
FT                   /note="This is a diverged copy of the CTV coat protein"
FT                   /gene="p27"
FT                   /product="p27 protein"
FT                   /function="minor coat protein"
FT                   /protein_id="CAJ21289.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVRAVVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CTARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 222 A; 134 C; 166 G; 201 T; 0 other;

 AM071488  Length: 723  August 30, 2005 08:46  Type: N  Check: 6643  ..

       1  atggcaggtt acacgatgct tcccaaaact gatgacaaag aaatggaccc
      51  ggtgagggcc gtcgtgcccg gtaagtaccc ggacgttatc gaaaagtttg
     101  tgaccaatag gtcggtagat gcgttaatag aaggtgttat tagcaagttg
     151  gatactaatt caatatacga agattccact gaaaaattta ctggtgagca
     201  attgaagtac gtcatggtta ctatggacac tttcttacta gaaaattaca
     251  aaacgaaaac ggaagatctg ctggttcact tagctatgat tcaaaagagg
     301  ttgtgcacta tatctacgag tactaaaacc aaatttcgtg ataaaggttg
     351  tatcagttac gtgcaagggg gtttacgata taagttaatg gataaagtag
     401  tttttccttt tattatatct aagtttactg acagggagac tccaaacgct
     451  ctacgtaagt atgcttgtac ttttgaggag ttacacttgt gcacggctag
     501  gctgagaccc gacttatacg aaaacaaaag gacgaccaaa gctgggactc
     551  cgcatttaaa gggctactta tcagctgact ttcttacggg ttcactccca
     601  ggatactccg aacacgaacg aggtatcatt cttcgagctt ctgaatctat
     651  gttagctaga cgtcaaggtt acgaggaggc aaccgagctt cttaacttac
     701  gcgatttagg aaagtatttg tag