Sequence of DPV Citrus tristeza virus

Citrus tristeza virus cp gene for coat protein, genomic RNA

ACC No: AM075622

Dated: 2005-08-26 | Length: 675 | CRC: 886476981

                !!NA_SEQUENCE 1.0
ID   AM075622   standard; genomic RNA; VRL; 675 BP.
XX
AC   AM075622;
XX
SV   AM075622.2
XX
DT   17-AUG-2005 (Rel. 84, Created)
DT   26-AUG-2005 (Rel. 85, Last updated, Version 2)
XX
DE   Citrus tristeza virus cp gene for coat protein, genomic RNA
XX
KW   coat protein; CP gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-675
RA   Chiemsombat P.;
RT   ;
RL   Submitted (16-AUG-2005) to the EMBL/GenBank/DDBJ databases.
RL   Chiemsombat P., Plant Pathology, Kasetsart University, KamphaengSaen Camp,
RL   Malaiman Road, Kamphaeng Saen, Nakhon Pathom, THAILAND.
XX
RN   [2]
RA   Chiemsombat P., Larprom A., Setou W., Kusolputharag P.;
RT   "In vitro expression of Citrus tristeza virus coat proteins and use of
RT   virus detection.";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .675
FT                   /country="Thailand:Kamphaensaen district"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="KPS27"
FT                   /isolation_source="leaf"
FT                   /specific_host="Citrus hystrix"
FT   CDS             1. .675
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAJ27152.1"
FT                   /translation="MDDETKKLRNKNKETKGVDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFSRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVFIQAKEQLLNKRGADEVVVTNGQGSLGKFN
FT                   TR"
XX
SQ   Sequence 675 BP; 191 A; 127 C; 178 G; 179 T; 0 other;

 AM075622  Length: 675  August 30, 2005 08:46  Type: N  Check: 2389  ..

       1  atggacgacg agacaaagaa attgaggaac aaaaacaagg aaacgaaagg
      51  agtcgacgat gttgttgcag cggaatcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  agtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga cttagaatgt gctgtgttca tacaagctaa agaacaattg
     601  ttgaataagc gaggggctga tgaagtcgta gttaccaatg gtcagggcag
     651  cttggggaaa ttcaacacac gttga