Sequence of DPV Ophiostoma mitovirus 1a

Ophiostoma mitovirus 1a RdRp gene for RNA-dependent RNA polymerase, genomic RNA

ACC No: AM087548

Dated: 2006-06-29 | Length: 3147 | CRC: -1249206819

                
ID   AM087548; SV 1; linear; genomic RNA; STD; VRL; 3147 BP.
XX
AC   AM087548;
XX
DT   29-JUN-2006 (Rel. 88, Created)
DT   29-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Ophiostoma mitovirus 1a RdRp gene for RNA-dependent RNA polymerase, genomic
DE   RNA
XX
KW   RdRp gene; RNA-dependent RNA polymerase.
XX
OS   Ophiostoma mitovirus 1a
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus; unclassified Mitovirus.
XX
RN   [1]
RP   1-3147
RA   Buck K.W.;
RT   ;
RL   Submitted (25-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Buck K.W., Biology, Imperial College London, Sir Alexander Fleming
RL   Building, London, SW7 2AZ, UNITED KINGDOM.
XX
RN   [2]
RA   Doherty M., Coutts R.H.A., Brasier C.M., Buck K.W.;
RT   "Sequence of RNA-dependent RNA Polymerase Genes Provides Evidence for Three
RT   More Distinct Mitoviruses in Ophiostoma Novo-ulmi Isolate Ld";
RL   Virus Genes 33(1):41-44(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3147
FT                   /organism="Ophiostoma mitovirus 1a"
FT                   /specific_host="Ophiostoma novo-ulmi"
FT                   /isolate="Ld"
FT                   /mol_type="genomic RNA"
FT                   /country="United Kingdom"
FT                   /virion
FT                   /db_xref="taxon:348094"
FT   CDS             408. .2756
FT                   /transl_table=4
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="CAJ32466.1"
FT                   /translation="MKYFYTWQRGSKDLFLINKGLLQVLRLVWGDTTLNKIRAFYVLLL
FT                   RLEFIRKHNGLPYLCGYMKACGIFLMKTVGKDPSKLDLTSLGIWVSLTGSGIPRIIPSY
FT                   IRNRIRSHDLKLVKSVLTVFNLYRVLDFAGSLNLATITDPSDGITPPSFDKWMKAFTRK
FT                   FILDFKISSTMAPWLIQSSGPCSKKGCNNTEGWLTAIRRLKHLFTWGEITSILDPYKEG
FT                   KWEKSDFYSFWASIQPLTDNVPIGKLAAKEEPGKVRIFAMVDAVTQWLLKPLHEAIFKL
FT                   LNIFAFDGTFDQIGQLEKFMDRMKDKAPYYYSFDLSAATDRLPLSIQILILKHLVSVPF
FT                   SEAWGRLLTGRTYHLFYKKTSYEVQYQVGQPMGALSSWGMLALTHHLVVQYSAYLAFGK
FT                   VNLFKDYIVLGDDIVIGNHEVSIRYHYLMTEILKVKINPTKGIMSPHSLEFAKRFYVQY
FT                   QDCSPLSLKEFSSFGTVYSSFTASLRKLDISVPNLLTLVGRGGRARGHQGTALSSLLEM
FT                   MRVNLINFSKSQPMTFLNIFFPSLTESMVKSILIDYLASSGKLKDLSLLLRDGPASYPK
FT                   EKRTENLGLDQVKESNKLILANFSQDLKLHKKFFGALDAFMMKTGGNIPQVTKTKLPIK
FT                   DKAPVFFRGVSPLHDTIQFGLTPESRDLIKSLLLGINTSSFCSSELELVPITKLLTLYF
FT                   TDVNSLVTVNGHPFNKVKPNRSFLRNWEEIYSGISLLKLVVSYSSSLHLVRVASDKVLI
FT                   SNFLRSLEKETSPRSFAPTYXDEVDTVSE"
XX
SQ   Sequence 3147 BP; 989 A; 538 C; 583 G; 1034 T; 3 other;

am087548 Length: 3147  29-JUN-2006  Type: N  Check: 3690  ..

       1  tattgttatc aatctagccc cagtaaagtt actggggatc ctcttaagtg
      51  agttattaat aattcatcta agagggcctt taactacaag tgccaatcaa
     101  gccctcaact cagttgatag acttgacttt gaagctcttg caggcttaca
     151  attcttttgg gctgataccc tgattgaatt ggtgtcatag tattgactgc
     201  ttttgacctt gattgacttc gcaccataag gggaggagtg atcctctcgc
     251  ttatgagaac gaagaaaatg ttaagattta acatttaggt tgcaccctgc
     301  ctactgatct caaatgagat gacagaaggt atagaataaa tcattcataa
     351  attaagaaca tcactaacaa taatatttta caattactgc aagcgatgct
     401  ctttagaatg aagtatttct atacttggca aagaggttcg aaagacctct
     451  tcctgattaa taaaggactt ttacaagttc ttagattagt ctggggagat
     501  acaactctaa acaaaatcag agcgttttat gtcttgttac taagactgga
     551  attcattaga aaacacaatg gccttccata cctttgcggg tatatgaagg
     601  catgtggtat tttcttaatg aaaacagtgg gtaaagatcc aagtaaacta
     651  gacttgacct ctttaggaat atgagtatct cttactggat ctggtatacc
     701  tagaataatt cctagttata tcagaaacag gattagatct catgatctca
     751  aattggttaa atcggtttta actgttttta acctttatag ggtcttagat
     801  tttgctggtt cattgaacct tgcaactatc acagaccctt ctgatggtat
     851  tactcctcct tcttttgaca agtggatgaa agcttttaca agaaaattta
     901  ttcttgattt taagatttca tctactatgg ctccttgatt gatacaatca
     951  agtgggcctt gttcaaagaa gggttgtaat aatacagaag gttgattaac
    1001  agctattaga agattaaaac acctcttcac atgaggtgag ataacttcta
    1051  tcttagatcc ttacaaagaa ggtaaatggg agaaatccga tttctactcc
    1101  ttctgagctt ctattcaacc tttaactgat aacgtaccaa ttggtaagtt
    1151  agcagcaaaa gaagaaccag gaaaagtgag aatattcgct atggttgatg
    1201  cagtcactca gtgactgttg aaaccattgc atgaagcaat ttttaaattg
    1251  cttaatatct tcgcttttga tggaactttt gaccaaatcg gtcaattgga
    1301  gaagttcatg gatagaatga aggataaagc tccttattac tattcttttg
    1351  acctatcggc agccacagac agactaccat taagtataca gattctgata
    1401  ttgaaacact tggtttcagt accattctct gaagcttggg gtaggctgtt
    1451  gactggaaga acctatcact tgttttataa gaaaacaagt tatgaagttc
    1501  aataccaagt aggtcaaccc atgggagcat tatcttcttg aggtatgctg
    1551  gctttgactc accatttggt ggttcaatat tcagcgtacc ttgcctttgg
    1601  aaaggttaat ctctttaaag attacatagt cttaggagat gatatcgtta
    1651  ttggaaacca tgaggtttct ataaggtatc attacctgat gactgaaatc
    1701  ttaaaagtta agattaatcc tacaaargga ataatgtccc ctcactctct
    1751  tgaatttgca aaaagatttt atgttcaata ccaagattgc tcccctttat
    1801  cattaaagga gtttagctct tttggtactg tctattcatc ttttactgca
    1851  agtctaagaa agttggatat ttctgtacct aaccttctta ctttagtagg
    1901  aagaggggga agagcaagag gtcatcaagg tacggcacta tcatctctat
    1951  tagagatgat gagagttaat ttaattaact tctcaaagtc ccaacctatg
    2001  actttcttga atatcttctt cccttctctt actgagagta tggttaagtc
    2051  aatcttaatt gattatctag cctcttcagg taagttgaag gatctgtctc
    2101  tattgttaag agatggtccc gcttcttatc ctaaggagaa aagaacagaa
    2151  aatcttgggt tagatcaagt taaagaatct aacaaactga ttttggctaa
    2201  ttttagtcaa gatctaaagc ttcacaagaa attctttgga gctctagayg
    2251  cgttcatgat gaaaacagga ggtaatattc cccaggtaac taagactaag
    2301  ttacctatta aggataaagc tccagttttc tttagaggag tttctcctct
    2351  tcatgacaca attcagtttg gattaactcc tgagagtaga gatctaataa
    2401  aatctctctt actaggaatt aatactagtt ctttttgctc aagtgaactt
    2451  gagttggtgc cgataactaa attgttgacc ctgtatttta cagatgttaa
    2501  cagtttagtt actgtgaacg gtcacccttt caataaggtt aaaccaaata
    2551  gatctttctt aagaaattga gaagaaatct attctggtat ttctttattg
    2601  aaattagtag taagctatag ctcgtctcta catttggtta gagttgcctc
    2651  agataaggtt ttaatatcta acttcttaag aagcttagaa aaagaaacct
    2701  ctccaagatc atttgctcca acttatrtag atgaggtgga tactgtttct
    2751  gagtaagaaa ctttattcca tctccattct atctctaata ggtctaatga
    2801  ttaaggatga atctgaatta tattaatcag atttacctat aactgaaaca
    2851  agagtaaact cttgagtcta gactagtacc actttaatta caacagctaa
    2901  gctggacctc aaatcaatga ggtttggtct gtactattat tattggagtt
    2951  tgaaatctcc ttcacccata tctgggatag taatattaag atcaagtaag
    3001  taaataaggg tgttattaga gaaggtttca cgcggtaaaa agaccacgtg
    3051  atctggattt gatggctatt agttatagta caagtgtaca atatctcatc
    3101  taagagagcc ccctagctta ggggggtacg aaaggtagac ttatcaa