Sequence of DPV Ophiostoma mitovirus 3b

Ophiostoma mitovirus 3b RdRp gene for RNA-dependent RNA polymerase, genomic RNA

ACC No: AM087550

Dated: 2006-06-29 | Length: 2332 | CRC: -355724475

                
ID   AM087550; SV 1; linear; genomic RNA; STD; VRL; 2332 BP.
XX
AC   AM087550;
XX
DT   29-JUN-2006 (Rel. 88, Created)
DT   29-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Ophiostoma mitovirus 3b RdRp gene for RNA-dependent RNA polymerase, genomic
DE   RNA
XX
KW   RdRp gene; RNA-dependent RNA polymerase.
XX
OS   Ophiostoma mitovirus 3b
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus; unclassified Mitovirus.
XX
RN   [1]
RP   1-2332
RA   Buck K.W.;
RT   ;
RL   Submitted (25-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Buck K.W., Biology, Imperial College London, Sir Alexander Fleming
RL   Building, London, SW7 2AZ, UNITED KINGDOM.
XX
RN   [2]
RA   Doherty M., Coutts R.H.A., Brasier C.M., Buck K.W.;
RT   "Sequence of RNA-dependent RNA Polymerase Genes Provides Evidence for Three
RT   More Distinct Mitoviruses in Ophiostoma Novo-ulmi Isolate Ld";
RL   Virus Genes 33(1):41-44(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2332
FT                   /organism="Ophiostoma mitovirus 3b"
FT                   /specific_host="Ophiostoma novo-ulmi"
FT                   /isolate="Ld"
FT                   /mol_type="genomic RNA"
FT                   /country="United Kingdom"
FT                   /virion
FT                   /db_xref="taxon:348096"
FT   CDS             31. .2247
FT                   /transl_table=4
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="CAJ32468.1"
FT                   /translation="MKNLFTIQRKAVIKNSTTRLPNHLWLGYVKVLVWLYDIPSAHRTY
FT                   FFELLNRIQSLRRNSGDTWTVGYLKESHRLSSHWLSGNPDVCSGSIRVSVRGLPLIIPG
FT                   RLRNAIYSRNNINITRALLTLLSTFRVMSAKPKLKLSTITDPFNGVNETLPSLEVSRAL
FT                   KNILQGNKFVFKKEDINDPYSVNRLMDITKAGPNGGVSLRNVIIDAYALMKHPKVYASL
FT                   LELSNVMSPYLGLLLRNQTTIIRAITDFDPIKWERIKPFMAPVYQSIKDQTLNLIPDLS
FT                   CIGKLSTKEEAAGKVRVFAMVDIWTQSILNPLHKKIFSIIRELPTDGTFDQLKPLDRLH
FT                   ELSTQDRFSFDLSAATDRLPLTLQKDILTLLVSPSFAEAWGTALVGRPYKLKFGTTEDE
FT                   LMYSVGQPMGALSSWGMLALTHHTIVQVAASRAGYKDLFLDYALLGDDICIANKAVADN
FT                   YLLIMHDLGVEINLSKSLISSTGVVEFAKRWRVGQTDVSPASPALITRLLSNMNYFPVL
FT                   ILDLVNRGVKTIQNSEKLLSLPDSLQKIKKSITFSLIPYYDPEFAKCLLPLKGKDKSFS
FT                   QEELFALYVHTDRIFNKLGLLEFHKAKDGDQENSKLSQSYLYNILDNSELPLPAITSQI
FT                   DNILIAQMKTITNVPIRNWLDNRDINLLTFECWHSYLIDTLSELSSISKVVPDYTIIKD
FT                   NEKPDNLEMRRNLLFMQELIKDLKKWNPGIFEIIPESILKEEEV"
XX
SQ   Sequence 2332 BP; 804 A; 384 C; 384 G; 760 T; 0 other;

am087550 Length: 2332  29-JUN-2006  Type: N  Check: 6628  ..

       1  tatagtcaac tttaatttaa ttataaacaa atgaaaaatt tatttacaat
      51  acaaagaaaa gctgttataa aaaatagtac tacacgttta cctaatcatt
     101  tatgattagg atatgtgaag gtactagtat gattgtatga tataccaagc
     151  gcacatcgaa cctatttctt tgaacttctt aacagaattc aaagtcttag
     201  gcggaacagc ggtgatactt gaactgtagg atatcttaaa gaatcccata
     251  gattaagttc tcactgacta tcaggaaatc ctgatgtctg ttccgggtca
     301  attcgagttt ctgtacgagg actacctttg attattccag gtagattaag
     351  aaatgctatt tattctcgta ataatattaa tattactcga gcattattaa
     401  cactcttatc tactttccga gtaatgtctg ctaagcctaa attaaaactt
     451  agtacgataa cagacccatt taatggagtt aacgaaactc ttccttcatt
     501  ggaagtttct cgtgctctaa aaaatatatt acaaggaaat aagttcgtct
     551  ttaagaaaga ggatattaat gatccttatt ctgtaaatag acttatggac
     601  ataacaaaag caggtcctaa tggtggtgta tcacttcgga atgttatcat
     651  tgatgcttat gcattaatga aacatcctaa ggtatatgct tcactattag
     701  aattatccaa tgtaatgtct ccatacttag gattattgtt gagaaatcaa
     751  acaacaatca taagagcgat tactgatttc gatcccatta aatgagaaag
     801  aatcaaacct tttatggctc cggtttacca gagtataaaa gatcaaacac
     851  ttaacctgat acccgactta agttgtatag gtaaactatc aactaaagaa
     901  gaagcagcag gaaaagtgag agtattcgct atggttgata tatgaacaca
     951  gtcaatatta aatcctcttc ataagaagat atttagtatt atccgtgaac
    1001  ttccaactga tggtacattt gatcaattga agcctttaga tcgattacat
    1051  gaactatcta cacaagatag attcagtttc gatttatctg ctgcaactga
    1101  tcgattaccc ttgactcttc aaaaagacat tcttacctta ttagtaagtc
    1151  catcttttgc agaggcttga ggtacagctc ttgtcggtag accatataaa
    1201  ttaaaatttg gtactactga ggacgagctg atgtattcag ttggtcaacc
    1251  tatgggggca ttatcctcgt gaggtatgct tgctttaact catcatacga
    1301  tagttcaagt agcagcctct cgagcaggat ataaagactt gtttctagat
    1351  tatgcacttt taggagatga tatttgtata gctaataaag ctgtagcaga
    1401  taattatctc ttgattatgc atgatctagg ggttgagatt aacctatcta
    1451  aatctttgat ttcatcaact ggtgttgttg aatttgcaaa aagatgaaga
    1501  gttggacaaa cagatgtttc tccagcctct ccagctttaa taacaagact
    1551  tttaagtaat atgaattact ttccagtctt aatattagat ttagtgaata
    1601  gaggtgtgaa aaccatccag aattctgaga aattactttc tcttccggat
    1651  tcattgcaga agataaagaa aagtataact ttttctttaa tcccctacta
    1701  tgatcctgaa tttgcgaaat gtttactacc cttaaaaggg aaagataaat
    1751  cgttttcaca agaagaattg tttgctttat atgttcatac agaccgaatt
    1801  tttaacaaat taggtctact tgaattccat aaggcaaaag atggtgacca
    1851  agagaattca aaactctctc agtcgtattt atataatatc cttgacaata
    1901  gtgaattacc gttaccggca atcactagtc aaatagataa tatattaata
    1951  gcacaaatga aaactattac taacgttcca attaggaact ggttagataa
    2001  tagagacatt aatctactaa catttgaatg ttgacattca tatttaatag
    2051  atactctttc agagttatct tctatttcta aggttgtacc agattacact
    2101  atcattaaag ataatgaaaa accggacaac ttggaaatga gacgaaatct
    2151  cctcttcatg caagaactta ttaaagatct taagaagtga aatccgggta
    2201  tatttgaaat tataccagaa tccatcctga aagaggagga agtttaatat
    2251  gtagctacta ttagacttac agtattcaca tactgtgcat taactttgtt
    2301  tattttcctt taaaagctgc ataagcaaca ga