Sequence of DPV Phlebiopsis gigantea mycovirus dsRNA 1

Phlebiopsis gigantea mycovirus dsRNA 1 ORF1 and RdRp gene, genomic RNA, isolate TW2

ACC No: AM111096

Dated: 2011-10-05 | Length: 11563 | CRC: 584928809

                ID   AM111096; SV 3; linear; genomic RNA; STD; VRL; 11563 BP.
XX
AC   AM111096;
XX
DT   11-OCT-2007 (Rel. 93, Created)
DT   05-OCT-2011 (Rel. 110, Last updated, Version 5)
XX
DE   Phlebiopsis gigantea mycovirus dsRNA 1 ORF1 and RdRp gene, genomic RNA,
DE   isolate TW2
XX
KW   .
XX
OS   Phlebiopsis gigantea mycovirus dsRNA 1
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RC   revised by [3]
RA   Coutts R.H.;
RT   ;
RL   Submitted (07-OCT-2005) to the INSDC.
RL   Coutts R.H., Division of Biology, Imperial College London, Sir Alexander
RL   Fleming Building, SW7 2AZ, UNITED KINGDOM.
XX
RN   [3]
RC   revised by [5]
RA   Coutts R.H.;
RT   ;
RL   Submitted (18-MAY-2009) to the INSDC.
RL   Coutts R.H., Division of Biology, Imperial College London, Sir Alexander
RL   Fleming Building, SW7 2AZ, UNITED KINGDOM.
XX
RN   [4]
RX   DOI; 10.1007/s11262-009-0364-z.
RX   PUBMED; 19430898.
RA   Kozlakidis Z., Hacker C.V., Bradley D., Jamal A., Phoon X., Webber J.,
RA   Brasier C.M., Buck K.W., Coutts R.H.;
RT   "Molecular characterisation of two novel double-stranded RNA elements from
RT   Phlebiopsis gigantea";
RL   Virus Genes 39(1):132-136(2009).
XX
RN   [5]
RP   1-11563
RA   Coutts R.H.;
RT   ;
RL   Submitted (19-MAR-2010) to the INSDC.
RL   Coutts R.H., Division of Biology, Imperial College London, Sir Alexander
RL   Fleming Building, SW7 2AZ, UNITED KINGDOM.
XX
RN   [6]
RA   Lim J.M., Jamal A., Phoon X., Korhonen K., Coutts R.H.;
RT   "Incidence of Phlebiopsis gigantea large virus-1 in a collection of
RT   Phlebiopsis gigantea isolates";
RL   Arch. Virol. 0:0-0(2011).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .11563
FT                   /organism="Phlebiopsis gigantea mycovirus dsRNA 1"
FT                   /host="Phlebiopsis gigantea"
FT                   /isolate="TW2"
FT                   /mol_type="genomic RNA"
FT                   /country="United Kingdom:Norfolk, Thetford Forest"
FT                   /isolation_source="host found on Pinus sylvestris"
FT                   /collected_by="B.J.W. Greig"
FT                   /db_xref="taxon:349681"
FT   CDS             730. .6768
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:A8KAR0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A8KAR0"
FT                   /protein_id="CAJ34331.3"
FT                   /translation="MHSRPHARGGSMDFQWNFSAVTACTWMQATAILLSVSQAREGLKL
FT                   SCTPSLLFPFLALFFFSDFVILRFLLSVVAIVAATPVFLVGAFTGAGLAFSRRRCRRPS
FT                   RAQRLAAYRLGHRRPHSPRPRQPRRTRLRARCPPSHKKGRGVTGPTIKRSSRPGPRFAR
FT                   RANGGLLGPGVIPYSDQGWDNVLCPAPPVKKSGGDLGPTIKKSAPSAPCPAQPRTPPVR
FT                   RETPRAYQLRRAQLAERAVRRQEKWYEYLGRVRAREVFRADVQAFVSEFGLASVLLSSS
FT                   PTKRALADNIGLVGIETNPGPSAATSTDVASQVLSCTTSWLGRRSYRFTAFVGPIWDGD
FT                   AYARQEIAYLRMRAVCHFGVLLAGLLVLLLHRVVTSRPLVLSQLAPGDFLPRGRSLNWA
FT                   SERGKTVCQAWLVSRKSVLITTRGPESSNPEFVGTDSGVGGSLELGEDPSAGIAREVRE
FT                   EVGIDIDGCDVQVGAVEVDSGFTVVWVIVYLADEPEPCVPASEKEKVISPRWVEFSSVD
FT                   TSRMHPRTAHSFGQCLPKFYTGAEFASCSSEAQATWLRRGSAGDMPPGLWSLRLINNRD
FT                   GLCVPYAMQAVSGLEFDFADLAARVPPAGYDFRALAPNPADWACWSADRKAWVVGNPET
FT                   AKYFLFHKMNGKFGHVDGLVRASLGEPVSDTVFYPTGRGGFDNARDEFVAYAMDSIKDL
FT                   DGPAVRCDTYRQKMGECLTLDETELSNWLVSWHSANLNGGKGPSPNPQPPSPPTSRTPP
FT                   PPPDPTSDGLGLPADPSSGAGDLKTGANITGLSAAEGPLKLTGSLDTVSVVADRRVQEV
FT                   PVDVDSLYTQPELGTEVTFGAPASGYDNLGRLLLVDSVADDVDVVSDLLAXTVTVYYGF
FT                   KDRLSXFFGKEILSFIPGLNRHTEVIGRNMVPGDYADKYSTTVKEFTAIFAEIIGASMV
FT                   LGSRLTNWVTTVDEVPGASYAPLYERLWAGWLAAAHGATLRAQGARNVNGHGGGNVDPH
FT                   FNVVFPNQIGFLDVFDLSAAPVAGWPKAMGANAVSGTTMVPLRISGGPRYPTPAAGRDW
FT                   RVVLYHLTSRYMDLESPASLQAPNLPRTRANLANAPSFFPMFDAQLPSLMFVCDTIHFG
FT                   RNNAPFPAYAGNAAASMQNPDAWRDALVFMLQAVGGSEDAMQAFQNVAERWAYFYPGDQ
FT                   THLANPLANRIRRAELVYDALRRRLLHMRLVRPNVDAGNVADPTTAASFKLYSTAAPAG
FT                   VDVSRAALTAAAAAPGWATVRDVLGAAAAIADLPAQDLTGLVLAQANGTTDAMWHQYFQ
FT                   NVTLDGPGSPALSEFLSSMPEADWESCRLWLSWDWSPNFPVQARPVAAQIARHTVALRN
FT                   RAGADLHHNDRAAARALSRGLDLSNEWTLPLANLVEQRTVVVPNGVRAMRSAKVSARIY
FT                   HDDTLALVLARRLADQSFTSQGLTTRFALLAVQMRAGIDAVTASVDLNASTLRLRTGEA
FT                   QTGVVLIDRVLEDTNEYVRFGKMGDYHSAYVSLAGNSILNAGYPSKMLNEFGVLRRLEF
FT                   ADTSNFVYDTTDAAAATEKSLLLWRTLHPVTVRFFRPDVAVQGGPVVKDLDLFGIYTQG
FT                   AQLPWEDWVVNFTWRKPVAALGALRIVLSVSGAALKIRAIVDFLPTRGRRVPREHEVLS
FT                   NVSQLVPRYGIMGTHSPVLKEDLFSWYHCPLVFRLRVDEVNGDLDWIRPAPIWEYGSVP
FT                   RTCGTPAVLNYNARRVHVFASTTAAPNPNSAFPGQLGSWAAGGLGRSDYIYLPGMSTSG
FT                   SRHHYSGQDGLPTRRHASSESFFSVQQSGNYVYMRSPAAVAHATPRLIAGYGHNVPLAY
FT                   TGPNGNAMVVGFFNGALAGMSQDARFGTWTEITYGDPRGQAALGRDTLQRFYALVPVYM
FT                   HRWERWYSKMGRDYLPVILSPRLDIVVSTPSTLEGTLTDLGSRALADSAAAKLIGGFRS
FT                   QDPDFMPAERTTANFDPRIIDVPIRQGHIDHFLTGFSSTTAVGEQLSTEGKTAARKKRL
FT                   RHKADLVAKMSEELAEEGFV"
FT   CDS             7224. .11468
FT                   /gene="RdRp"
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /note="ORF1 and RdRp gene potentially encode fusion
FT                   proteins which are apparently expressed by a translational
FT                   frame shifting mechanism."
FT                   /db_xref="GOA:A8KAR2"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:A8KAR2"
FT                   /protein_id="CAJ34333.2"
FT                   /translation="MSPDEGRAVAHQTDVAARGMDRSAASHLNLEVSGGSENEHTTALP
FT                   RSLVWAELIDKLGKDGQRYAIAIPSGEGKTFLKNTCPALFTDHDDLEDQRIAGPLYRAA
FT                   VASGDYSALNAYHHSTSLSARTPVLLTWGKETCAPGMFTFLGAHLLLESTGIRENAGNR
FT                   EGLIRSGDFVYSVSFESRDALIAKSLKTKRRPYLWDLPSSVVSRHPLFSALANKKYPQL
FT                   IAAAEEIARAGDMIHKGAYAVVKEYYDMFLRDVVSQVLSFNDGVVLHKLAFNGQLPDVM
FT                   YQLYDKHAPEQLPDYSDAKAVLDKGAPKGTYHGAHVYDAKTLFRGVQGKRRAHEYGSMS
FT                   FQDISDLARTNAVVLVGPPATGQWLYAAPIRRYNPAFPDLPGIFVSPSTPPASNSVVPI
FT                   GYSYWLLYSYFKRAGLTAARAKREAHREYALTTGLKKIGLQGETTGAPTKRRKWETGQA
FT                   RRSRLVRANAALVETVDDIQTKVRASRTEALKRERALDEPYLIGYQSNPNVQTHLRNQI
FT                   ERLLLALGVDDALAVDLLRELYPFKDEELLARTRVDAFLVVKLLERLSIKYGVGYVKGV
FT                   LVGTGGLGLQGIAGFALYALSSADAATYVAVLSHNHILCHGIKPATQFLKAVQTVTRRI
FT                   QRLPSYFPHSWPDYSPLPRAQFNPSAVSILYVNLLVGRAQDELLGFDGYVEKRNGADWI
FT                   QKSITTSSDPKKRAKVWDQLSTAAMRRMAVHTASALNQARNPDGVGDLTPSGFLAHFVT
FT                   VAPRGSIGTGKDDLRPYGIPLHNAHKRLWLDSIPPDQLPQVIERPAEVFTNAQVKTESG
FT                   LRLRQIIPGEIHQWLIESIAMYRIEPALFKGISSFTLGSTPVSMMIADLKRWWRTRHGR
FT                   YTLATDYADFNYLHTLEDMKRFWRIVVLEPALTLAGPGDWDGVNYAGFVAKCAEWQIDA
FT                   LDKLYVREVGSDGMYRRVTRSLWSGWRTTTMINNTMNLVYNEINRSVCETELGYDPIYD
FT                   GHVNGDDGDFEVRCLSDALFYLRHLDIEKLDVQASKQLLAASHAEYLRIDYTPQGIRGS
FT                   IARSCASFVGGDLQDPVIDVGPDYVRGTSEAINVMIRRGFDPFEGEWLRDTVCGYYAYI
FT                   KVQLMDGSERVSRLTDTRKLYVPYSDGGYGLVRYATPSSTRLATTRKWPSARGSWTLDK
FT                   VPHHGVGAACRAAIGRFARRGMQFAHPEVLYRMYASLASQGVDNVTNKWWQDLDRAQLA
FT                   DHLDWLNKVDVVYREHVSSLSSRQVDLVKSAVDRVLTRDPYESHIYEIPSIKQALAEYS
FT                   SRLLGLASVGPQLLQDIVDTSTGERLTVAQIAQAFGEEMNERYKFFGFYPATFIDLILD
FT                   HGYELPVTTLGVCPDYLLPLLDLIVSDVTNAYEPQLEGVQQLKDYYDRLLRDAITTAEL
FT                   YLYQTYPHLLKT"
XX
SQ   Sequence 11563 BP; 2270 A; 3508 C; 3080 G; 2702 T; 3 other;

am111096 Length: 11563  05-OCT-2011  Type: N  Check: 2664  ..

       1  gtcaaaaaag cccccctccg tcaggagggt gcgtgctttt tctgactcga
      51  ctgcactgtc gatcaacgag tgcgctagaa cgatcagaac ggttcaactg
     101  aacctagtag gacgttcggc tgatacactt ttacccctcc atatctgggg
     151  gggtgatgtg tattgcggac gaaggagggg ccaccatcag tctgcgcggc
     201  cgaaagcgcg ctcatgttcg tatgtgtttg tatgcgttcg tctcttgtct
     251  cacagctttt cttgaaatat gttaaattat atatgccaca aaaaacataa
     301  attatgaaaa attgtctacc cgcactggag cctcctcgag gcgtcagatg
     351  gtaacgctcg ttttagacga gtggcgaatg ccagtgcacg gcggcctagt
     401  ccactccccc cagtccacga tgattcgaaa ttgtcgcgtg tgctggcggg
     451  ctaggtgtta atcctcaggg tccgcgaccg gccattccag cgtaccaatt
     501  ttacgggagc tccgtgcctc cacctcccag tggaggagcg aggagacctg
     551  tttttgcgat cggttggagg ctagcctagt aactccgcgc acgagtagta
     601  gttcgccttt tcgcgacgtg gcttggtacc ccgtgcctca tctttaggga
     651  tgaggagcga ggggtgctgg gcctaggtcc caagaggttc gagcgagtcc
     701  acagactgca caggtttcca gggtcgcgga tgcacagtcg ccctcacgcc
     751  aggggggggt ccatggattt ccagtggaac ttttcggccg tgaccgcctg
     801  cacatggatg caggccacgg ccatcttact ctctgtctca caggcccggg
     851  aaggccttaa gctgtcatgc accccatctc ttcttttccc cttcctcgca
     901  ttgtttttct tttccgattt tgttatcttg cggttcctcc tgtccgtggt
     951  cgccattgtc gcggccactc cggttttcct ggtcggcgcc ttcacaggtg
    1001  ccggcctcgc tttcagccgt cgtcgctgcc gccgcccctc gcgcgcgcaa
    1051  cggctcgcgg cttaccgtct cggccatcgc cgcccccact cccctcgtcc
    1101  gcgtcagccc cggcgcactc ggctacgggc acgttgcccc ccttcccata
    1151  aaaaaggaag gggggtcaca ggccctacca ttaaaaggtc ttctcgcccc
    1201  ggtccccgtt tcgcccgccg cgccaacggt ggtctactcg gccccggtgt
    1251  tataccctat tccgatcagg gatgggataa cgtgctgtgc ccagcccctc
    1301  ccgtaaaaaa aagcgggggg gacctgggcc ctaccattaa aaagagtgca
    1351  ccttccgcgc cttgccccgc ccagcccagg acccctcctg tacgccgcga
    1401  gacccctcga gcgtaccagc tcagaagggc ccaacttgct gagcgtgcag
    1451  tccggcgtca ggaaaagtgg tacgagtatc ttggtcgtgt gcgagcacgt
    1501  gaagtgttcc gtgccgacgt ccaggccttc gtcagtgaat ttggcctcgc
    1551  gtccgtcctc ctttcgtcca gcccgacgaa gcgtgctctc gccgacaaca
    1601  tcggtttggt cggcatcgaa actaaccctg gaccctccgc cgccacgtct
    1651  accgacgtcg cctcgcaggt cctttcctgc actacgtcct ggttgggtcg
    1701  ccgatcctac cggtttaccg ctttcgtcgg tcctatctgg gacggcgatg
    1751  cctacgcgcg acaagaaatt gcgtatctgc gcatgcgtgc ggtttgccac
    1801  ttcggtgtac tgctcgcagg cctgctcgtt ctcttacttc atcgcgtcgt
    1851  gacgtcccgc ccccttgtgc tatcccaact tgcacctggc gattttctgc
    1901  cgcgcgggcg ctcactcaat tgggcgtccg aacgtggcaa gaccgtttgt
    1951  caggcttggc tcgtgtcgcg taaatctgtt ctcatcacga cacgcggccc
    2001  tgaatcgtct aatcccgagt ttgttggtac agactcgggg gtgggcggtt
    2051  cgcttgaact aggtgaagat ccttccgccg gtatcgctcg cgaggtgcga
    2101  gaagaggtgg gtatcgacat cgacggctgc gacgtccaag tcggagccgt
    2151  cgaggtcgat tccgggttta ccgtcgtctg ggtcatagta tacctggccg
    2201  acgagcccga accttgcgtc cctgcgtccg aaaaagagaa ggtcatttcc
    2251  ccacgttggg tggaattctc ctctgtcgac acgtcgagga tgcacccccg
    2301  taccgcccat tccttcggtc agtgtctacc taagttttac actggtgccg
    2351  agtttgcatc ctgctcctcc gaggcgcaag caacttggtt acgccgaggc
    2401  tcagccggtg atatgcctcc cggcctatgg tcactccgcc tgattaacaa
    2451  tcgggatggt ctttgtgtgc cgtatgccat gcaggcagtc tccggtcttg
    2501  aattcgactt cgcagacctt gcggcgcgcg taccccctgc cggttacgac
    2551  ttccgcgccc tagccccgaa tcctgccgac tgggcatgct ggtctgcgga
    2601  tcggaaggcc tgggtcgtcg gcaacccgga gactgccaaa tacttcctct
    2651  tccacaagat gaacggcaag ttcgggcacg tcgacggact ggtgcgtgcg
    2701  tctctagggg aaccggtttc agataccgtg ttctacccta ctgggcgggg
    2751  cggctttgac aatgctcgtg atgagtttgt cgcgtatgcc atggacagta
    2801  tcaaggacct cgacggcccc gccgtccgct gtgatactta ccgccagaag
    2851  atgggcgagt gtcttacttt agatgagacg gagctcagta actggttagt
    2901  gtcgtggcac agcgctaacc taaacggcgg caagggcccc agtccgaacc
    2951  cgcagccgcc cagtccccca acttcacgga ccccgccccc tccccccgac
    3001  ccaacttcag acggcctagg tctcccggct gacccgtcca gtggtgccgg
    3051  tgaccttaag accggtgcca acattacagg tctttcggca gccgaaggac
    3101  cgctgaaatt gacaggttcg ttggataccg tgtccgtcgt cgcagaccga
    3151  cgcgtgcagg aggtccccgt tgatgtcgat tccttgtata cgcagccgga
    3201  actcggtact gaagtaactt ttggtgcccc agcttccggt tacgataacc
    3251  tgggtcgact cctgttagtg gattctgttg ctgacgacgt tgacgtggtt
    3301  tccgacctcc ttgccngcac ggtcaccgta tactacggtt tcaaggatcg
    3351  gctttctnng ttctttggga aagagatcct ctctttcatc cctggcttga
    3401  accgccacac ggaagtgatt ggccgtaaca tggtaccggg tgattacgcc
    3451  gacaaataca gtactactgt caaggagttc actgctatct tcgccgaaat
    3501  tatcggtgca agtatggtcc tcggctcccg gctcacgaac tgggtcacga
    3551  cggtcgacga agtccccggt gcttcctacg ctccactcta cgagcgtctt
    3601  tgggctgggt ggctcgccgc agcgcatggg gcaacccttc gcgcacaagg
    3651  tgctcgtaac gtcaacggcc acggtggagg caatgttgat cctcatttca
    3701  acgtcgtctt ccctaaccag ataggtttcc ttgatgtgtt cgatttatcg
    3751  gcggcacctg tcgctggttg gcccaaagcc atgggcgcga atgcagtctc
    3801  tggtacgact atggtgccct tacgtatttc cggaggccct cgttatccta
    3851  cccccgctgc aggtcgtgac tggcgtgttg ttttatacca cctaacgtcg
    3901  cggtacatgg acctcgagtc tcctgcgtct ctgcaggccc ctaacctccc
    3951  aaggacgcga gctaaccttg caaatgcacc gtccttcttt cccatgttcg
    4001  acgcccaact cccgtccttg atgtttgtct gcgacacgat ccatttcggt
    4051  cgtaacaacg ctccattccc cgcgtacgct ggaaacgcag ccgcatcgat
    4101  gcagaatcct gacgcctggc gtgatgcact cgtcttcatg cttcaagctg
    4151  ttggtggttc tgaggacgcg atgcaggcat tccagaacgt tgccgaacgg
    4201  tgggcgtact tctaccccgg ggaccagact caccttgcga atccgttggc
    4251  caaccgtatt cgtcgggctg aattggttta cgacgcgctg cgtcggcgcc
    4301  tgcttcacat gcgtctcgtt cgcccgaacg ttgatgctgg caacgttgct
    4351  gatcccacaa ccgctgcgtc gttcaaatta tactcaacag ccgctcctgc
    4401  cggtgttgac gtgtcccgcg cagccctgac cgccgccgcc gctgcacccg
    4451  gttgggccac ggtccgtgat gtgcttggcg ctgctgccgc gatcgcagac
    4501  ttgcccgccc aagaccttac tggcttggtc cttgcacagg cgaacggtac
    4551  gacggatgcc atgtggcacc aatacttcca aaacgtgact ctcgacgggc
    4601  ccggttcacc cgcactgtcg gaattcttgt cttccatgcc ggaggctgat
    4651  tgggagagct gtcgtctttg gttatcttgg gactggtccc cgaacttccc
    4701  tgtccaagcc cgccctgtcg ctgcgcagat tgcacggcat accgttgctt
    4751  tacgtaaccg tgccggcgcc gatctgcacc ataacgatcg tgctgcagct
    4801  cgggcgctct cacgcggcct ggacctttcc aacgaatgga cccttccctt
    4851  ggctaacctc gtcgaacagc gcactgtcgt cgttcctaat ggcgttcgcg
    4901  ccatgcgatc ggctaaggtt tctgctcgga tctaccacga cgatactctt
    4951  gcacttgtgt tggcacggag attggccgat caatccttca cgtcgcaagg
    5001  tttaaccaca cggtttgccc tacttgccgt gcagatgcgt gccggcattg
    5051  atgcggtaac tgcatccgtg gatctgaacg cgtctacact ccgtctacgc
    5101  accggcgagg cccagactgg agtggtactc atcgaccgtg ttttggagga
    5151  taccaatgag tacgtgcgat ttggaaagat gggagattac cacagtgcgt
    5201  acgtttcact tgccggtaat tccattctga acgctggtta cccttcgaag
    5251  atgctgaacg agtttggtgt cctgcgtcgc ctcgagttcg ctgatactag
    5301  caacttcgtg tacgatacca cggacgccgc tgccgcaacc gagaagtcac
    5351  ttctcctgtg gcgtacgctc caccccgtga ctgttcgctt cttccgtccg
    5401  gatgtggccg ttcagggcgg gcctgtcgtt aaagatctcg acttgttcgg
    5451  catctataca cagggtgccc aactgccttg ggaagactgg gtggtcaact
    5501  tcacttggcg taagccagtc gcggctctcg gcgccttgcg aatcgtcctg
    5551  tctgtctcag gcgctgcgct caaaatccgc gcgatcgttg atttcctccc
    5601  gactcgcggc cgccgagttc ctcgtgaaca cgaggttctt agcaatgtgt
    5651  cgcaactcgt gccgcgttac ggaataatgg gaactcattc ccccgtactc
    5701  aaggaagatc ttttttcctg gtaccattgt ccgctggtct tccggctacg
    5751  cgtcgatgaa gtgaacggcg atttggattg gatacgccct gcaccgatct
    5801  gggaatacgg ttccgtgcct cgtacatgtg gtactcctgc cgtgttgaac
    5851  tacaacgcgc gtcgggtaca tgtgttcgct tccaccactg ccgcacctaa
    5901  tccaaactcc gcgttccccg gccagttagg gagttgggca gctggtggcc
    5951  taggtcgtag cgattacatc taccttccag gtatgtcgac ctctggttcc
    6001  aggcaccact acagcgggca ggacggtttg cctacacggc gccacgcatc
    6051  ctcggagtct ttcttctcag tccagcagag cggcaactac gtgtacatgc
    6101  gctcacctgc tgcggttgcc catgctactc cgcggctgat agctggctac
    6151  gggcacaacg ttcccctagc ctacaccggg cctaacggca atgcgatggt
    6201  tgtcggcttc ttcaacggtg ctctcgcggg tatgtctcag gatgctcgct
    6251  tcggtacgtg gacagagatt acctacggcg accctcgcgg tcaggcagca
    6301  ctaggacgtg ataccctaca acgtttctac gccctcgtgc ctgtctacat
    6351  gcaccgctgg gagcgttggt attccaagat gggccgtgac tatctaccgg
    6401  tcattctttc cccgaggctg gacatcgtcg tctcgactcc ttccacgctc
    6451  gaggggactc tcaccgatct tggttcgcgt gcattggccg acagtgctgc
    6501  agctaaactt attggcgggt tccgttctca ggacccggac tttatgccgg
    6551  ctgaacgtac aacggcaaac ttcgacccgc gtattatcga cgtccctatt
    6601  cgtcagggac acatcgacca cttccttacc ggtttctcca gcactacggc
    6651  tgtgggcgaa cagctgtcca ctgaaggtaa aaccgccgcc aggaaaaaac
    6701  gccttcgcca taaggcggac ctggttgcaa aaatgagtga ggagctcgcg
    6751  gaagagggtt ttgtctaagc cccttcttcg taggcagtaa acctaatact
    6801  gcctctaagt tctctgtgtc cggacgcgcg gctgtaaacc gcgacgctga
    6851  cctcgatatc ctgctggcgg gatgtcgtgc aacaaaaaat tcaaaaatat
    6901  ggacggaagc ggtcctgagg agacgtcacg aaacggctgg tccgtcggcc
    6951  gcgagtgcag ctgggctgtg caatcaacaa ctgctggtgg atagtacccc
    7001  gaacccccct attagtgatg ctggacccac cggtgctggc ccaagagcta
    7051  agctttctgc gcgagcttct cgtttgcgcg tctgcgaccc cacggttggc
    7101  gccaccggga ccggcggaac gaacggtgtg cacggttccc tctgtccacc
    7151  tgttaccgcg ggcgttcctt gtacggaacg gcctgtattc aaagccaccc
    7201  ctgccatatc gcaggctccg tccatgtcac cggatgaggg tcgagcggtg
    7251  gcgcatcaaa ctgatgtcgc tgcccggggt atggatcgtt ccgctgccag
    7301  ccacttaaac ttagaggtga gcggcggttc tgaaaacgag cacacgaccg
    7351  cgcttccacg cagcctcgtt tgggcagagc ttatcgacaa gctcggcaaa
    7401  gacggtcaac ggtatgccat cgccatcccc tccggcgaag gtaaaacctt
    7451  cctaaaaaac acgtgtcctg cgctcttcac tgatcacgac gacttggagg
    7501  accagcggat agccggtccg ctctaccgcg ctgctgttgc ctccggcgac
    7551  tactctgcgc tgaatgcata ccaccacagc actagtctgt ctgctaggac
    7601  ccctgtactt ctcacctggg gtaaagaaac gtgcgcacct gggatgttta
    7651  ccttcctagg ggcccattta cttcttgaaa gcacaggtat tcgtgagaac
    7701  gcgggcaatc gcgagggttt aatccgcagc ggtgactttg tctactccgt
    7751  atccttcgag tcccgtgatg ccttaatcgc caagtcgctc aagaccaagc
    7801  gtcgccctta cctctgggac ctaccttctt cagtagtatc acggcacccc
    7851  ttgttctctg ccttggccaa caagaagtac ccgcagttaa tcgctgctgc
    7901  ggaggaaatt gctcgggcag gtgacatgat acacaagggt gcctacgccg
    7951  tcgttaagga atactatgat atgttcctgc gtgatgttgt ctctcaggta
    8001  ctgtccttta atgacggcgt tgtgcttcac aagcttgcct tcaacggcca
    8051  gttgcccgac gttatgtacc aactgtatga caagcacgct cctgaacagt
    8101  tacctgatta ctcggacgcc aaggctgtac tcgataaggg tgctcccaaa
    8151  ggtacgtatc acggggcgca cgtatacgac gcaaagactc tattccgtgg
    8201  tgtccaaggt aagagacgcg cgcatgagta cggctcaatg tctttccaag
    8251  atatttccga cttagcccgc accaatgccg tcgtcctcgt gggaccccct
    8301  gcgacaggtc agtggctgta cgcggcacct atccgcagat ataacccagc
    8351  tttcccagac ttaccgggta tcttcgtgtc accttcaacc cctcctgcct
    8401  ctaacagcgt cgtccccatc ggctactcgt actggctttt atactcgtat
    8451  ttcaagcgtg ccggtctgac ggccgcccgg gcaaaacgcg aagcccaccg
    8501  cgagtacgcg cttactacgg gcctaaaaaa aataggtcta caaggtgaga
    8551  cgaccggagc ccctaccaaa cggcggaaat gggaaacagg ccaggcaagg
    8601  cgatctcggc ttgtccgggc gaacgctgcg ttagttgaga ctgttgatga
    8651  catacagact aaagtacgcg cctcacggac tgaagctctc aaaagagagc
    8701  gggctctgga tgagccgtac ctcattggtt accagagtaa cccgaacgtg
    8751  cagacgcacc ttcgtaacca gatcgagcgc ctcctacttg ccctcggggt
    8801  tgacgacgct ctagcggttg acctactacg cgaattatac cccttcaagg
    8851  acgaggaact cctcgcccgg acgcgtgtcg acgccttcct cgttgttaaa
    8901  ctactggagc gtctcagcat taagtacggg gtagggtacg tcaagggcgt
    8951  cctggtcggt actggtggat taggcctaca gggtatcgcc gggttcgctt
    9001  tatacgcctt atcgtccgcc gatgctgcaa catacgtggc cgtcctctcc
    9051  cacaaccaca ttctctgcca cgggattaag cctgcaacgc aattcttgaa
    9101  agcggtacag actgttacta gacggataca gcgcctgcct tcctacttcc
    9151  cgcactcctg gcccgactac tcgcctctac cgcgcgcaca atttaatccc
    9201  agcgcggtgt ctattctgta cgtcaactta cttgtgggca gggcacagga
    9251  cgagctgctc ggattcgatg gttatgtgga gaagcgcaac ggagcagact
    9301  ggatacagaa aagtatcact acttcctccg atcctaagaa gagggcgaaa
    9351  gtatgggacc aattgtccac tgcagctatg cgtcgcatgg ccgtgcatac
    9401  cgcttccgcc ctcaaccagg ctcgtaaccc ggacggagta ggcgacctaa
    9451  ctccttccgg tttcctggct catttcgtca ccgttgcgcc tcggggttcg
    9501  attggtacag gaaaggacga cttacgcccg tatggtatac cgcttcacaa
    9551  cgcgcacaaa cggctctggc tcgattcgat acccccggat cagctacccc
    9601  aggttatcga gagaccggcc gaagtgttta ctaacgcaca ggttaagacg
    9651  gaatcaggat tacgcctgcg ccagatcatc cccggtgaaa tacaccagtg
    9701  gttgatcgaa tccatagcca tgtatcgtat cgagcctgct ctcttcaaag
    9751  ggattagctc tttcaccctc ggttccacac ccgttagcat gatgattgcc
    9801  gatctcaagc gttggtggcg gactcggcac ggccgctaca ccctagcgac
    9851  tgactacgcc gatttcaact acctacacac gttggaggat atgaaacgct
    9901  tctggcgcat cgtcgtactt gaacctgctc taaccttggc tggacccgga
    9951  gactgggatg gcgttaatta tgctggtttc gtcgccaaat gtgccgaatg
   10001  gcaaatcgat gccctagata aattgtacgt tcgcgaggtc ggttccgacg
   10051  gcatgtaccg gcgcgtgacc cgctccttgt ggtccggatg gcgtacaacc
   10101  accatgatta acaacaccat gaacttggtc tataatgaga tcaatcgatc
   10151  cgtatgtgaa actgaactcg gttacgatcc tatctacgac ggccacgtga
   10201  acggtgacga cggcgacttc gaggtaagat gcctctccga cgccctattc
   10251  tatctccgcc acctggacat cgagaagttg gacgttcagg cctcgaaaca
   10301  attattggcc gcgtcccacg ccgagtatct tcgcatcgat tacacaccgc
   10351  aaggtatccg cggttcgatt gctcgctcgt gcgcttcatt cgtgggtggt
   10401  gacttgcagg atcctgttat tgacgtgggt cctgactacg tgcgagggac
   10451  atcggaagcc atcaacgtga tgatacgccg cggcttcgac ccgtttgagg
   10501  gcgaatggct ccgcgacacc gtgtgcggct actacgcata tataaaggtc
   10551  caactgatgg acggttcaga gcgcgtcagt cgcctgaccg atacccgcaa
   10601  gttatacgtc ccctactccg acggtggtta cggtctggta cgctacgcca
   10651  ccccatcctc cactagactg gcgactacac gtaagtggcc gtccgcccgt
   10701  ggcagttgga cacttgacaa agtcccacac cacggtgttg gcgccgcatg
   10751  ccgagccgcc atcggtcgct tcgcccggcg cgggatgcag tttgcccacc
   10801  ctgaggtctt atatcggatg tacgcctcct tggcctcaca gggtgttgat
   10851  aacgtcacta ataagtggtg gcaggacttg gaccgcgcgc agttggcgga
   10901  ccacttagac tggctaaaca aagtcgatgt ggtctaccgc gagcacgtta
   10951  gttctttatc gtcccgacag gtggatttgg ttaagtctgc ggtcgaccgt
   11001  gtactgactc gtgatccgta cgaatcgcac atctatgaga tacctagtat
   11051  caaacaagct ctggctgagt attcttcccg attgctcggg ttagcttctg
   11101  ttggcccgca actcttacaa gacatcgttg acacgtcgac cggtgaacga
   11151  ctgactgttg cccagatcgc gcaggccttc ggtgaagaga tgaatgaacg
   11201  gtacaagttc ttcggattct accccgccac cttcattgac ctcatccttg
   11251  accacggtta cgaattacca gtaacgaccc tcggtgtttg ccctgattac
   11301  cttctaccgc tgttagatct aattgtttct gacgtgacca acgcctacga
   11351  acctcagctc gaaggcgtcc aacagctcaa agactactac gacaggctgc
   11401  tccgtgatgc tatcaccaca gcagaactgt acctatacca aacgtacccg
   11451  catctcctca agacttgacg tgtacaacaa ctcaatacaa aactatctag
   11501  tatagtaaag tatgaatatg aacgaatacg ttcgtgctga acagtataca
   11551  ctgtttcaga cgc