Sequence of DPV Phlebiopsis gigantea mycovirus dsRNA 2

Phlebiopsis gigantea mycovirus dsRNA 2 partial ORF1 and RdRp gene, genomic RNA, isolate TW2

ACC No: AM111097

Dated: 2009-06-29 | Length: 8727 | CRC: 809404959

                
ID   AM111097; SV 2; linear; genomic RNA; STD; VRL; 8727 BP.
XX
AC   AM111097;
XX
DT   11-OCT-2007 (Rel. 93, Created)
DT   29-JUN-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Phlebiopsis gigantea mycovirus dsRNA 2 partial ORF1 and RdRp gene, genomic
DE   RNA, isolate TW2
XX
KW   .
XX
OS   Phlebiopsis gigantea mycovirus dsRNA 2
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RC   revised by [3]
RA   Coutts R.H.;
RT   ;
RL   Submitted (07-OCT-2005) to the EMBL/GenBank/DDBJ databases.
RL   Coutts R.H., Division of Biology, Imperial College London, Sir Alexander
RL   Fleming Building, SW7 2AZ, UNITED KINGDOM.
XX
RN   [3]
RP   1-8727
RA   Coutts R.H.;
RT   ;
RL   Submitted (18-MAY-2009) to the EMBL/GenBank/DDBJ databases.
RL   Coutts R.H., Division of Biology, Imperial College London, Sir Alexander
RL   Fleming Building, SW7 2AZ, UNITED KINGDOM.
XX
RN   [4]
RA   Kozlakidis Z., Hacker C.V., Bradley D., Jamal A., Phoon X., Webber J.,
RA   Brasier C.M., Buck K.W., Coutts R.H.;
RT   "Molecular characterisation of two novel double-stranded RNA elements from
RT   Phlebiopsis gigantea";
RL   Virus Genes 39(1):132-136(2009).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8727
FT                   /organism="Phlebiopsis gigantea mycovirus dsRNA 2"
FT                   /host="Phlebiopsis gigantea"
FT                   /isolate="TW2"
FT                   /mol_type="genomic RNA"
FT                   /country="United Kingdom:Norfolk, Thetford Forest"
FT                   /isolation_source="host found on Pinus sylvestris"
FT                   /collected_by="B.J.W. Greig"
FT                   /db_xref="taxon:349682"
FT   CDS             <1. .5093
FT                   /codon_start=3
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="UniProtKB/TrEMBL:A8KAR3"
FT                   /protein_id="CAJ34334.2"
FT                   /translation="VSNMPRGTVGPRGHIASSALARSSRPRPPPLAGRSSLAPSRDHLL
FT                   PGPARLHPTARGPASLRRASHATSQYAAPFSGTGLPPGSITRGRPRGSRLGRSPSVPHT
FT                   TTPGGRLFRLDGVNVQQVLTHQATSNEVASTFFPAPALSPALLHRRALQLVRDLGLQGH
FT                   YEDLLLYKEDFPSAEALLDNVSDAWGLSQKERNALQHALNGNIAVPNSMTLGPLNVPYS
FT                   PFLASWRWDVGPITGAVLLPNGHGYQGVIHVPRPIVKWRLPKRQSVRMYNALLTAKRIF
FT                   ENINKIKLPVITRKLRHFMFRYHHRKSNAWRLNSAVAPQPHEAPQKQHQCLLDTLTKIS
FT                   ELHPEFKFSGSGPTLDHYKFHGLSTLPEVPIYWITSLEDSSRNHVSLDPFPGCHIEPLD
FT                   LXTLIKTFEHTPFYATLVQGLPVDSXRSAMDKAKYSVREAVASVPIPELSGVRAVPSEL
FT                   LAGPAPPSIDDSFSAVRDGHIPSFLTDQPLQLTDNFAPNDYTVEQTITGRKFQPEDDVV
FT                   LPSRWESSEPLVLLTAARNSNSNVYTRGTAEEISLPRHPKDVGMLDPRYGKLDSLWASD
FT                   FNENARKALDTVLAPYRAFGTRNERSLPNFENMRFNRFMSMNGFVQHASNGQRYLRVMY
FT                   ILFSRWVQSLAITEAVHSGSLGNSADNLNFGAVTNADVVQMANPAPLPHDQITYLGSTY
FT                   DQEKGNQGWGYVGAVPNSTPEDPFWNNSNQGALFDGDIAFIDADSVPTPVLREICNAFL
FT                   PQVGGNRWAVRVNRAQAGNQNQAAIDAAIAHNNNPPVQNQQAIDNTPAGANPPAPILAA
FT                   PRRIPAAQPFPPDYVYYSHNLGSTDIHGASRLFLHWGSTPATDIPPLRDLLGDGAMPDP
FT                   DPARNPWAAFDDRNVRTAPLERLTIEEAIKHLIIRHHCAEDARLAWDMVMYRTYAAYTP
FT                   GIPNPVPNAPNMRCWSTGGGRVALPKDYSAMAYLDWAFKPLNVPTHISDLLRTPGRVLL
FT                   NSVWYANYAVFNAINWPSHTLSFRGAQIHQARNLPQGRNAGNNNVRRHVTEIARVYRRD
FT                   AMSNFNAAHQSAVARMYGFCPGPLFWVTSDRTPLNFWRNHQSAYFVNPYFFLWGQEILP
FT                   LHQMLPVANSCPLWPDNEPKPIQSIRDVGAGVRVGRSLMGFESLNWIQDGGMEYSLRHY
FT                   AAITQNSWTRADTPDPAVHAWVDPARLATWNTPFQYEMPAAPAQVDFTYMRPVGDSIWS
FT                   NFILPGSIDSYNVATNRVSAHAAATSPNYWNDGERARTWFRMSNGQPSNCVTLTIEPPV
FT                   GFTREFQLENEYQVVTVFENARPDSILYMVVTAAELAAMSSTHTNNQYYAGDRTSTLSF
FT                   PAYLANHNRPHEPTRPSFLPKGRPSKPAPPPSPEPQNTPPTHNTRSGSPTLSYESHNPR
FT                   HVSEVPTMPATITTQTVDGAAKINAPAYQYHGASPSAIRAEAQRLTELAAAAESSNFAL
FT                   PPPSSIPPVEHSTTPPVIGPKSGPISRDSTSITYARIPRHNSVVRDGILDSNNDRLTKN
FT                   VIVDGIVRYPAGSRLPGNPVAAASKAAWATPPPKPPPRAPLNTEGLRPNTPWLPNPPTM
FT                   PVTTQPPPPAIPTFGGLDDSEWEAFRTKAKTEKAESDDRINEILARFRLMESSSGSNPP
FT                   PSRPLAPPLTLPASINVPSSEIPLNDKAATNAQEGLTDLSALAGPNGVPDFLRLRPEN"
FT   CDS             5219. .8680
FT                   /gene="RdRp"
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /note="ORF1 and RdRp gene potentially encode fusion
FT                   proteins which are apparently expressed by a translational
FT                   frame shifting mechanism"
FT                   /db_xref="GOA:A8KAR4"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:A8KAR4"
FT                   /protein_id="CAJ34335.2"
FT                   /translation="MMSFIRDFTVKQSDSGAPDTSPPIMKFKEAVDFYDLDSPPSDLPG
FT                   AALRFVLFEPLPSEVWNFLDPLLFWNEEFKDYPEVLSELSGPQMPEHTPSPKNVNLGQE
FT                   LDRLYPQNSGRPGGKIHLMCSDVLQTAKNYWSQQLGIRLYYGVNDWGNVAAASLVMLPL
FT                   LSSAAQEFIAPRLTVARSMFNLPFSDFTKVCKALHTSIRVTKTVPVAGGYSRISTEQAR
FT                   QLYGLDLLPGPSELHKFDPQAEILQRATPGANPLWPSIEKGAIHYSSLRYDQAFKNALT
FT                   LTMRELIPHTIRTPPTFSEWYNDRMAWAASGGAPGARVVWDEGTRGERINKRGALLAIP
FT                   EEDLRKVLIMSAGAVLYSKAASKFEKGKRRAIWNTAIEHYLFQAYILDIIDASAISEGA
FT                   SGLPVSWNAATHSSNQRLAAQIFRLDTLGRSVGLMWDFSDFNINHQKSASTAIFTMAVE
FT                   GIENAIDSNEDATITQVRRDLRACREWVNTAKLNQIFDSGETEPLVMPVLRCLASGERA
FT                   TSFTNTILSRVYRHMVNAWATEQLGYPLIKDGDSQQGDDVFAAVDSVSRGVITAATYNL
FT                   LGYAGQSYKVTLDYAPRGEFLRLSYDGVAGIVAGYPIRAGLGLISGEFFEESTFDPDAR
FT                   AAAYWEAVTKATRRGANIPQGLIDRLISRNCHITLTLPSGEKTRIVADVDVAITPSALG
FT                   GVGVTGGAPLPLRRKHKDPEAITTYSSPLGSRPLFSYPKVRASELLRRTKLADLSTLRR
FT                   LGFEGRELALASQSIVNSALTNAFRAEDRANAITDFASRLHKWKKTVQSVPIVLPPAAP
FT                   HLHVTSAIQTLWLEALGLDSTRADHGSNPIGYAIIIPSGEGKTTLKREFPELFIDHDDY
FT                   ISWQAVEHLADNGFNHALADYNRQRLLPKDKVLLTWGQDTVPPGYRVLMIPLIRDWEGP
FT                   RMNEENRAYLEKQREVSWFNSFEERNEAILAVVNQNLNSVRALSYNRRSHLIPNFSPVT
FT                   PLRHHFGMVSSLTRPLGFSLLEIMLNTVSDLPNTSKYPGQLGKWNTLFNSAIPRSAHGA
FT                   LNLQENISKFNTFARVGGDYQMDLRMDYLLGKLQFLPPTSMSHSADVIVTARDITLLIL
FT                   ERNLPNWFSLPLLEFLHSVSQLETSVLRMYTYYIQPTYLAGVLYID"
XX
SQ   Sequence 8727 BP; 2086 A; 2548 C; 1882 G; 2209 T; 2 other;

am111097 Length: 8727  29-JUN-2009  Type: N  Check: 8232  ..

       1  ctgtctctaa tatgccccgt gggacggtcg gccctcgcgg gcatatcgcc
      51  agctccgcgc tggcacgctc aagtcggccc cggccgcctc ccctcgcggg
     101  gagatcatca ctggccccct ctcgggacca cctcttgccg ggccccgctc
     151  ggcttcatcc tactgccagg gggcccgcct ccctgcgcag ggcgtcgcac
     201  gcgacgtcac agtacgcggc gcccttctcg ggcaccggac tccctccggg
     251  gagtattact cgtggaaggc ctcgcggctc tcggctcggg cggagcccat
     301  ccgtccccca caccaccact cccggtggtc gtctcttccg cctggacggc
     351  gttaacgtcc aacaggtgct cacgcaccaa gctacctcta acgaggtagc
     401  ttctaccttt ttccccgccc cggccctctc tccggccctc ctccaccgac
     451  gagcccttca gctcgtccga gatcttggcc ttcagggcca ctatgaggac
     501  ctcctcctct acaaggagga ctttccgtcc gccgaggccc tcctcgacaa
     551  cgtctccgac gcctggggct tgtcccagaa ggagcgcaat gcgctccaac
     601  atgccttgaa cggcaacatt gccgttccca actctatgac gctcggccct
     651  ctcaacgtgc cgtactcccc tttcctagct agctggcgct gggatgtcgg
     701  ccctataaca ggtgccgtcc tcctgcccaa cggccatgga taccagggcg
     751  ttatacacgt gccccggcct attgtgaaat ggcgtttacc caaacgtcaa
     801  tctgtacgca tgtacaacgc gctccttacc gcaaagcgca tctttgaaaa
     851  tatcaataag attaaattgc cggttatcac gcgcaaattg cgccacttca
     901  tgtttagata ccatcatagg aaatctaacg cctggagact aaactccgcg
     951  gtagcacctc aaccgcacga agctccacaa aaacaacacc aatgtctcct
    1001  cgatacacta actaaaatta gtgaattaca tcctgaattt aaattctcag
    1051  gttccggtcc aaccctagat cattacaaat tccatgggct gtcaactctt
    1101  cctgaagtac caatttattg gatcacttca cttgaagaca gttctcgcaa
    1151  tcacgtatcg cttgatccgt tccccggttg ccatatagag ccacttgacc
    1201  tcnaaactct cattaagact ttcgagcaca ccccgttcta tgctacgcta
    1251  gtccaaggtt tacctgtcga ctcancacgg tcagctatgg ataaagcgaa
    1301  atattccgtt cgagaagcgg tcgcttccgt tccaatcccc gagctttcgg
    1351  gtgtacgagc cgtgccgtca gaactactcg ccggacctgc ccccccctcc
    1401  atcgatgact cgttctcggc tgttcgggat ggccatatcc ccagtttctt
    1451  aactgaccag cccctacagt tgacagataa ctttgctcct aatgattata
    1501  ctgtcgaaca aacaatcact ggccgtaaat tccaacccga ggatgatgtt
    1551  gtactacctt ctcgatggga atccagcgaa ccacttgtcc tgctcaccgc
    1601  agctcggaac tcaaattcca acgtctacac tcgtggcacg gctgaagaga
    1651  tttctttacc acgccacccc aaggacgttg gcatgcttga ccctcgctac
    1701  ggtaagctag attcactttg ggcttccgat tttaatgaga atgcacgaaa
    1751  agcgttagat acggttctag ccccgtaccg tgcttttggc actcgtaatg
    1801  agcgaagtct acctaacttt gaaaatatgc ggttcaatag gttcatgtct
    1851  atgaatggct tcgttcaaca tgctagcaat ggccaacgct atctgcgagt
    1901  catgtatatc ctgttctcta ggtgggtgca atcgctagca atcactgaag
    1951  ctgttcattc cggcagcctg gggaattccg ccgataatct taatttcggc
    2001  gcagtcacca acgctgatgt cgtccaaatg gcgaacccgg ctccattacc
    2051  ccacgaccaa atcacctatc tcgggtctac ttatgatcaa gagaagggta
    2101  atcaaggttg gggttatgtt ggagcagttc ctaattctac cccagaagac
    2151  cctttctgga ataattccaa tcagggtgcc ctcttcgatg gtgatatcgc
    2201  ttttatcgat gctgattcgg tacccacacc agttctgcgt gaaatatgta
    2251  acgctttcct tccccaagtt ggtgggaatc gatgggcagt tcgtgtcaac
    2301  cgcgctcagg ccggaaatca gaatcaagcc gctattgatg ccgccattgc
    2351  tcacaacaac aatccccccg tccagaacca gcaggctatt gataacactc
    2401  ccgccggagc taacccccct gcccccatct tagccgctcc tcggcgcatc
    2451  cctgcggccc aaccattccc gcccgattat gtttattact cacataatct
    2501  aggatccact gatatccatg gtgctagtcg cctcttcctt cactggggat
    2551  cgactcctgc cactgatatt ccacccctac gtgatctgtt aggtgacggc
    2601  gctatgcccg accctgatcc agctcgcaat ccttgggctg cctttgacga
    2651  tcgcaatgtc cgtactgccc ctctcgaacg tctcacgatc gaggaagcta
    2701  ttaagcatct tattatacgt caccactgtg ccgaagatgc ccgcttggcc
    2751  tgggacatgg taatgtatcg tacttacgca gcttacaccc ctggtattcc
    2801  gaaccctgtc cccaacgccc ccaacatgcg ttgctggtca accggcggtg
    2851  gccgagtcgc tttacctaag gattactctg cgatggcata tcttgactgg
    2901  gccttcaaac ctctcaatgt gcctacacat atctcggacc ttttaaggac
    2951  tccgggacga gttttgctaa atagtgtttg gtatgctaat tacgccgtct
    3001  ttaatgctat taattggcca tctcacacac tctcattccg tggcgctcag
    3051  attcaccaag cccgtaatct tcctcaaggt cgtaatgctg gcaataataa
    3101  cgtcaggcgc cacgtcacgg aaatagctcg tgtatatcgt cgagatgcaa
    3151  tgtccaactt taatgcagcg caccaatctg ccgttgcgcg tatgtacggt
    3201  ttctgccccg gaccactatt ctgggtgact tctgatcgaa ctccacttaa
    3251  tttctggagg aatcaccaat ctgcatactt cgttaacccc tactttttcc
    3301  tttggggtca agaaattcta cctctccacc agatgcttcc tgtagctaat
    3351  tcttgcccgt tatggcctga caacgagcct aagcccattc aatctatccg
    3401  agatgtgggc gctggcgttc gtgtgggccg tagtcttatg ggtttcgaat
    3451  ctttaaactg gatacaagac ggcggtatgg aatattctct acgccactat
    3501  gcagctatca ctcagaatag ctggacccgt gctgatactc ctgaccccgc
    3551  cgttcatgcc tgggttgatc ccgctcgtct cgccacgtgg aatactccgt
    3601  tccagtatga aatgccagca gctcccgccc aggtagattt cacatacatg
    3651  cgacccgtcg gtgatagcat ctggtcaaac ttcatcctcc caggctcaat
    3701  cgactcttac aatgtggcaa ctaatcgagt ttctgcccac gctgcagcca
    3751  cttctccaaa ttactggaat gatggcgaac gagctcgcac ctggtttagg
    3801  atgtccaatg gtcaaccatc aaattgtgtt acccttacaa ttgagccacc
    3851  agtaggtttc actcgtgaat tccaacttga gaatgaatat caggtcgtta
    3901  ctgtgtttga aaatgcaaga ccagattcca ttctttatat ggtagtcact
    3951  gctgctgagt tagcagctat gtcgtctacc catactaata atcagtatta
    4001  tgctggtgat cgtacttcca ctttgtcctt cccagcttac cttgccaatc
    4051  ataatcggcc ccatgaaccc actcgacctt ccttcttgcc aaagggtcgg
    4101  ccttccaagc ctgcaccacc gccttcacct gagcctcaaa atacccctcc
    4151  cacacataat actcgctctg gctctccaac cttaagttat gagagtcaca
    4201  acccgcgtca tgtgtctgag gtgcctacta tgcctgctac tattactaca
    4251  caaactgttg atggagcagc taagattaac gcccccgcgt atcagtacca
    4301  tggcgcctcc cccagcgcta tccgcgctga ggctcagcgc ctcaccgagt
    4351  tagcggctgc agcggagtct agcaatttcg ctctcccccc ccccagcagt
    4401  attccccctg ttgaacattc caccaccccc ccggttattg gccccaaatc
    4451  cggtccaatt agtcgtgaca gcacttcaat cacttatgct cgtataccac
    4501  gccataattc tgtggtgcgt gatggtatac tcgattcgaa taatgaccgt
    4551  ctgactaaga atgtcattgt tgacggaata gtccgttacc cggcgggttc
    4601  ccgtctgcca ggcaacccag tagctgcagc tagtaaagca gcttgggcta
    4651  ctccgccacc caaaccccca ccacgtgccc cacttaacac ggagggttta
    4701  cgtccgaaca ctccttggtt accaaacccc cccactatgc cggtcactac
    4751  gcaaccacca ccacccgcaa tacctacgtt tggtggctta gatgactcag
    4801  aatgggaagc tttccgcact aaagcgaaga ctgagaaagc tgagtcggat
    4851  gaccgtataa atgagattct tgctcgtttc agactaatgg aatctagctc
    4901  tggctcaaac cctccgccat ctagaccgct tgccccacct cttactctcc
    4951  ctgcgtctat caacgtgccc agctctgaaa tccccctaaa cgataaagct
    5001  gccactaatg cccaggaagg cttaaccgac ttatctgcac tagcaggccc
    5051  caatggtgtg cctgatttcc tcagattacg tccggaaaac tagtctggaa
    5101  cgcagcttgc ggccgggcgg ccttcgagcg ttcctcgcga ttaatcgcgc
    5151  actatcactc tctgctggaa aaagagaaac ctgacgcttc tagtgagatc
    5201  ccgggccttt tggccacaat gatgtctttc atccgagatt tcaccgttaa
    5251  acagagtgat agtggggcgc ccgacacctc cccccccatc atgaagttca
    5301  aagaagccgt cgatttctac gatcttgact ccccgccctc tgacttgcca
    5351  ggcgccgctc tacgcttcgt cttattcgaa ccactgcctt ctgaagtctg
    5401  gaatttcctc gatccattac tcttctggaa tgaagagttt aaagattatc
    5451  ccgaggtatt atccgaactt agcggtcctc aaatgcctga acacacacca
    5501  agtcctaaga atgtaaactt gggccaggag cttgatcggc tttaccccca
    5551  gaattcaggg cgtccgggag gcaagatcca tctaatgtgc agtgatgttt
    5601  tacaaactgc aaaaaactac tggtcacagc agttaggcat acgcttatat
    5651  tatggtgtta atgattgggg gaatgtcgct gctgcttctc tcgtcatgct
    5701  ccccctgttg agtagcgccg ctcaagagtt tattgcccca cgcttgactg
    5751  tagcccggtc catgttcaat ttgccgttct cagactttac aaaagtctgt
    5801  aaagcgctgc atactagcat ccgagtcact aaaactgtac cagtggcagg
    5851  cggctattcc aggatttcaa ccgaacaagc taggcagtta tatggtttag
    5901  atttattgcc aggcccttca gagttacata aattcgatcc ccaggctgaa
    5951  atcctccagc gagctacacc aggagcgaat ccactttggc cttccattga
    6001  aaaaggcgca atccactact ctagtctacg atatgatcaa gcctttaaaa
    6051  atgcgctgac cctaactatg cgtgagttaa tcccacatac gatacggact
    6101  ccaccgacat tcagtgaatg gtacaatgac cgtatggctt gggcagctag
    6151  tgggggggct ccaggcgcaa gagttgtctg ggatgaaggc actcgaggcg
    6201  agaggatcaa taagcgtggt gcattacttg ccattccgga agaagacctg
    6251  cgtaaagtac taattatgtc agctggtgcc gtattgtact cgaaggcagc
    6301  atccaaattc gaaaaaggca aaaggcgagc tatctggaat accgctatag
    6351  aacactacct attccaggcg tatatcttgg atattattga tgctagtgct
    6401  atttccgaag gtgcttccgg tttaccagtt tcttggaatg cagctaccca
    6451  ctcaagtaac caacgtttag ccgctcagat attccgacta gatactcttg
    6501  gtcgttcagt tggtctgatg tgggacttct cagactttaa catcaatcac
    6551  caaaaatctg caagtactgc tatattcact atggcagttg agggtatcga
    6601  gaacgcaata gattcaaatg aggatgctac catcactcag gtccgacgtg
    6651  atctccgagc ttgcagagaa tgggtgaata ccgccaagct taatcaaatc
    6701  tttgattcag gcgaaactga accactcgtt atgccagtac tcaggtgtct
    6751  agcatctgga gaacgagcca cctcctttac caatactatc ttatccaggg
    6801  tatatagaca tatggttaac gcgtgggcca cagaacagct gggctacccc
    6851  ttaattaaag atggagacag ccaacaaggt gatgacgtct tcgcagcagt
    6901  tgactctgtt tctcgtggag tgatcactgc tgctacttat aatctcttag
    6951  gttatgccgg ccagagttac aaagtcactt tagattatgc ccctcgcggc
    7001  gaatttctac gcttgtccta tgacggcgta gctggcatcg tagctggtta
    7051  ccccatacga gcaggtttag gcttaatctc tggagagttc ttcgaagagt
    7101  ctaccttcga cccggatgct agagcggccg catattggga agctgtcact
    7151  aaagctactc gccgtggagc taatatccca caaggtttaa tagatcgtct
    7201  cattagccgt aattgtcata ttaccttgac actaccgtcg ggagaaaaga
    7251  ctcgtatagt cgcggatgtt gatgtcgcaa tcacaccctc agcattgggc
    7301  ggcgtcggcg ttactggtgg agcacctcta ccgctgcgcc ggaaacacaa
    7351  agaccccgag gctattacca cttacagctc acctctagga tctagaccat
    7401  tattttctta tccaaaggtc cgcgccagcg aacttcttcg tcgcacaaag
    7451  ttggctgacc tgtcaactct acgacgttta ggtttcgaag ggcgggaatt
    7501  agctctagcc tctcagagta tcgttaactc tgctctgact aatgccttta
    7551  gggctgagga tcgcgctaat gcaattaccg atttcgcatc ccggctccat
    7601  aagtggaaga agacagtaca atctgttccg atcgtcttac ccccagccgc
    7651  accacacctc cacgtcacct cggctattca aacgctctgg cttgaagctt
    7701  taggcctaga ctcgactaga gctgatcatg gatcaaaccc catcggttac
    7751  gccattatca ttcccagcgg tgagggtaag actacgctca agagagagtt
    7801  cccagaactc ttcattgatc atgatgacta tatctcatgg caagcagtcg
    7851  aacaccttgc tgacaacggc ttcaaccacg ccttagcaga ttataatcgc
    7901  caacgtttgt tacctaagga taaagttctg ttgacttggg gccaagacac
    7951  agtcccgcct ggctaccggg ttttgatgat tcccctcata cgagattggg
    8001  aaggtccacg aatgaatgaa gagaaccggg cttatctcga aaaacaaagg
    8051  gaagtatcct ggttcaattc gttcgaagag cgcaatgaag cgatcttagc
    8101  cgtagtcaat cagaatctaa actccgtaag ggccttaagc tataatcgcc
    8151  ggtcccacct tatccctaac ttctctccgg tcacaccatt acgccatcac
    8201  ttcggcatgg tatcctccct cactcgccct ttgggtttca gtttgttgga
    8251  aatcatgctt aataccgtct ctgacctacc aaatacctcc aaatatccag
    8301  gccagttagg caagtggaat actctgttta attctgctat tccacgcagt
    8351  gcccatggag cacttaacct ccaagaaaac atcagtaagt tcaatacctt
    8401  cgcacgcgta ggcggagatt atcagatgga cttacgtatg gattatttac
    8451  ttggtaaact acaattccta ccccctacaa gcatgtcaca cagtgccgac
    8501  gttatcgtta ctgcccgtga tataacctta cttatattag aacgcaatct
    8551  accgaattgg ttctccctac cgttactaga gttcctacac tcagtaagtc
    8601  agctggaaac ctcagtactt agaatgtata cctattatat ccaacctaca
    8651  taccttgctg gagtcttata catagactaa tagcaagccc ccgagacaca
    8701  gcgtagaacc ccctacacta gtgttcc