Sequence of DPV Siegesbeckia yellow vein virus
Siegesbeckia yellow vein virus-[GD22] AV2 gene for precoat protein and partial AV1 gene for coat protein, isolate GD22
ACC No: AM230640
Dated: 2007-03-24 | Length: 504 | CRC: 525361548
ID AM230640; SV 1; linear; genomic DNA; STD; VRL; 504 BP. XX AC AM230640; XX DT 30-JUN-2006 (Rel. 88, Created) DT 24-MAR-2007 (Rel. 91, Last updated, Version 2) XX DE Siegesbeckia yellow vein virus-[GD22] AV2 gene for precoat protein and DE partial AV1 gene for coat protein, isolate GD22 XX KW AV1 gene; AV2 gene; coat protein; precoat protein. XX OS Siegesbeckia yellow vein virus-[GD22] OC Viruses; ssDNA viruses; Geminiviridae; Begomovirus; OC unclassified Begomovirus. XX RN [1] RP 1-504 RA Zhou X.P.; RT ; RL Submitted (24-JAN-2006) to the EMBL/GenBank/DDBJ databases. RL Zhou X.P., Zhejiang University, Institute of Biotechnology, NO. 268, RL Kaixuan Road, Hangzhou, Zhejiang, 310029, CHINA. XX RN [2] RA Wu J.B., Zhou X.P.; RT "Siegesbeckia yellow vein virus is a distinct begomovirus associated with a RT satellite DNA molecule"; RL Arch. Virol. 152(4):791-796(2007). XX FH Key Location/Qualifiers FH FT source 1. .504 FT /organism="Siegesbeckia yellow vein virus-[GD22]" FT /specific_host="Sigesbeckia glabrescens" FT /isolate="GD22" FT /mol_type="genomic DNA" FT /country="China:Guangdong province" FT /virion FT /db_xref="taxon:371408" FT CDS 112. .468 FT /transl_table=1 FT /gene="AV2" FT /product="precoat protein" FT /db_xref="GOA:Q14RU2" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q14RU2" FT /protein_id="CAJ76456.1" FT /translation="MKMWDPLINEFPETVHGFRCMLAIKYLQAVQLTYSPDTVGYDLIR FT ELIRILRTKDYGQATCRYSHFHSRLQGTSEVELRQPLSQQCCCPNCPCHQQKEDMGQSA FT HVQKAQNVQDVQKP" FT CDS 278. .>504 FT /transl_table=1 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q14RU1" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:Q14RU1" FT /protein_id="CAJ76457.1" FT /translation="MAKRPADIVISTPASKVRRRLNFDSPYRSSAAAPTVLVTNKRRTW FT VNRPMYRKPRMYRMYKSPDVPRGCEGPCKV" XX SQ Sequence 504 BP; 145 A; 113 C; 102 G; 144 T; 0 other; am230640 Length: 504 24-MAR-2007 Type: N Check: 9850 .. 1 taatattacc tgtggtcccc aaaaaaatga tctagaccgt tgctcaaagc 51 taactaaaaa atatccacgt atgcttttgt atatttaaat gtatttcctt 101 ttgatttata tatgaaaatg tgggatcctt taattaacga attccctgag 151 accgttcacg gttttagatg tatgcttgca ataaaatatc tgcaagccgt 201 tcaattgacg tactcccctg atacggtagg atacgattta attcgtgaac 251 ttatacgtat tttacgtact aaggattatg gccaagcgac ctgcagatat 301 agtcatttcc actcccgcct ccaaggtacg tcggaggttg aacttcgaca 351 gcccctatcg cagcagtgct gctgccccaa ctgtccttgt caccaacaaa 401 aggaggacat gggtcaatcg gcccatgtac agaaagccca gaatgtacag 451 gatgtacaaa agccctgatg ttcctcgtgg ttgtgaaggg ccatgtaagg 501 tcca