Sequence of DPV Epichloe festucae virus 1

Epichloe festucae virus 1 CP gene for outative coat protein and RdRp gene for RNA dependent RNA polymerase gene, genomic RNA, strain P23

ACC No: AM261427

Dated: 2007-02-27 | Length: 5109 | CRC: 1883933356

                
ID   AM261427; SV 1; linear; genomic RNA; STD; VRL; 5109 BP.
XX
AC   AM261427;
XX
DT   03-MAY-2006 (Rel. 87, Created)
DT   27-FEB-2007 (Rel. 90, Last updated, Version 4)
XX
DE   Epichloe festucae virus 1 CP gene for outative coat protein and RdRp gene
DE   for RNA dependent RNA polymerase gene, genomic RNA, strain P23
XX
KW   coat protein; CP gene; RdRp gene; RNA dependent RNA polymerase.
XX
OS   Epichloe festucae virus 1
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-5109
RA   Zabalgogeazcoa I.;
RT   ;
RL   Submitted (02-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   Zabalgogeazcoa I., Plant Production, IRNA-CSIC, Cordel de Merinas 40-52,
RL   Salamanca, 37008, SPAIN.
XX
RN   [2]
RA   Romo M., Leuchtmann A., Garcia B., Zabalgogeazcoa I.;
RT   "A totivirus infecting the mutualistic fungal endophyte Epichloe festucae";
RL   Virus Res. 124(1-2):38-43(2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5109
FT                   /organism="Epichloe festucae virus 1"
FT                   /specific_host="Epichloe festucae"
FT                   /strain="P23"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain:Salamanca"
FT                   /virion
FT                   /db_xref="taxon:382962"
FT   CDS             271. .2571
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="putative coat protein"
FT                   /db_xref="GOA:Q1M2S1"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR008871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1M2S1"
FT                   /protein_id="CAK02787.1"
FT                   /translation="MMSTAQTQNFQVRHLAPLTGAVADPVGGLLQRGKDFRRYRSGLSS
FT                   EIPGPGRTFVEYRSIFYEVGRHYGNISDALATPTPAAVRIDCSHTINETQAANFEGLAR
FT                   QYSNFASQWEKMDLCGIAERLARAIATQSVFGGVTTTHMRAGQPLRVVALGTLDSPQTA
FT                   STSSVFIPRTVDSVGSDHVFAVLCAAANGEGASVSTDVLRLDVSNNAPLVPAVAGAPLA
FT                   TACVEALRVLGANMEESGAGDLFAYAVTRGIHRVVTVVSHTDEGGILRDLLRHDAFRVP
FT                   YGGINASLRHYPALPSAAGSHESSIAAWVDGIALKTAAVAAHCDPLVPGVGGMYPTVLV
FT                   ASKGSISPPGTPEGDVSPDDARSLGRQLSADIGRFAPNYIRGLSALFGLQGYTAIAERH
FT                   LCATAGHYLEENSATNRHLLHKTIAPYFWVEPTSLIPRDFLGTSAESENYAAKVSPGCV
FT                   AHEPLFEKFAPLAQGTTMTCATAGFKMRTARTSGYVCSQAAAPASLAMIQLKQFDTQSV
FT                   VLAGDQGPISGDVVTKHRASSPLSSYLWVRGQSALPAPAEFINTQGCYGAKIKLVDWTD
FT                   DWDPESTDVPRPDQFATGVVAWRVSLPTGLPTGPSNAADRQARRARSRGAIALAQALNR
FT                   ARAFGEGASPTMEVSDVPPDLGLADLGHYDHTGFREHRSDPGKAQETGDGNPSPTPTLL
FT                   RGAAMPPTEQHKPQGGPRLPAPPPTMGRAAGPVGPPSTPAPPPPAPVIAPPTVSDPPPM
FT                   PEAATGAEPVPQA"
FT   CDS             2568. .5051
FT                   /transl_table=1
FT                   /gene="RdRp"
FT                   /product="putative RNA dependent RNA polymerase"
FT                   /db_xref="GOA:Q1M2S0"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:Q1M2S0"
FT                   /protein_id="CAK02788.1"
FT                   /translation="MIESTVADRANAAGSVGRYLEALLPSEYTRVVSTLPFDHQVSFVY
FT                   RPSWRHHKPTELQRVAAAFLLPRVPVQVSYSAGSILTLLNATLPNLPPRHTYHAGWSCD
FT                   SDATRKAFPLKANPAASNKVNVYLSEVCYDLRRTNPGEAMAAEAALQRVRSSGSVYNDQ
FT                   ATAVVLYGFCLARNGLPGAYDIALALLLNPDYAKSLTGVLKATGGNATAVGSLLVEANT
FT                   LLGRDVAPVDLGKEFNMRTQLRLARENMAEYPPDVLRATVRRVLLDELTRRAGSYELDY
FT                   PSLEEHWDSRWAWAVNGAQGGAITDKGLESAPRPPGATREYRRSWLERVEEDPRPQWDG
FT                   TTEVSASSKLEHGKTRAIFACDTVNYLAFEHLMSTVEANWRGVRVVLNPGKGGNMGMAM
FT                   RVQAARRRCGVSLMLDYDDFNSHHTISAMQIVVEEVCSITGYDPDLAARLVASLDKQYI
FT                   TLAGRRKLSVGTLMSGHRCTTFFNSVLNAVYVRLELGEPFYSETVSLHVGDDVYMGVRD
FT                   YVSAAYVIQRLADSPLRMNALKQSVGHVSTEFLRIATGARDCYGYLSRAVASIVSGNWV
FT                   NDTALAPFEGLAAMVASARSLANRGKTNLAPLLLVSSVLRIAKLGKRHYGKVSSLLDGT
FT                   VALGNGPQYSCGAHMRWCNPVVVRDTPDPWGYTELPLESVTAYLSRAASPLEWEVLGEA
FT                   GISVTEQMAAASYRKTYASLFWRGERLTLGPTLSKAPIGSASAEDLARATKPHGLLAQY
FT                   PLLLLARDRIPETLVRVALGKAGGNPHTSHLAYDAWGEYDHGCQIQTVLGYADAAAFGK
FT                   RTSADVLTSRTLMYV"
XX
SQ   Sequence 5109 BP; 982 A; 1658 C; 1421 G; 1047 T; 1 other;

am261427 Length: 5109  27-FEB-2007  Type: N  Check: 5610  ..

       1  tgatagacaa ggtctgtacc ccaacgttcc ctgtctgtct ctcccccccg
      51  gggcggcttc ggccggcgca ctaggcgcaa gacctagcag tgctgtctgt
     101  gcggttatca cgcagacgag ttggatgctc tggcagggtt caatcccctg
     151  ccgtgagccg tggtgtgcct gaagaagccc atgccacggg gcgcacatat
     201  atttgtatct gtttggagga gggttcctaa gatcccaaac tttacgaata
     251  tcccaactgc acagaaaacc atgatgagca ccgctcaaac ccagaacttc
     301  caggtccgcc acctggcccc ccttaccggc gcggtcgcag accccgtcgg
     351  tggcctcctc cagcgcggga aggacttccg ccgttatcga tccgggctct
     401  cttcagagat ccctggtccc gggcgcacct tcgtggagta ccgctcgatc
     451  ttctacgagg tcgggcgcca ttacggcaac atctctgatg cgctcgcgac
     501  gcccacgccg gcggctgtcc gcattgattg tagtcacaca atcaacgaaa
     551  cgcaggccgc taacttcgag ggcttggctc gccagtactc gaactttgcc
     601  tcccagtggg agaaaatgga cctttgtggt attgccgagc gcctggctcg
     651  cgctattgcc actcagagcg tcttcggggg cgtaaccacc acgcacatgc
     701  gtgcgggcca gcccctccga gtcgtagccc tcggtacgct cgactcgcca
     751  cagacagcga gcacatcgtc cgtgttcatc cctcgtactg ttgacagtgt
     801  ggggagtgac cacgtattcg ccgttttgtg tgccgctgca aacggggagg
     851  gcgcgtctgt ttctaccgac gtgctgcgtc tagatgtgag caataacgct
     901  cctctcgtcc ccgccgtggc cggcgccccc ttagctacgg catgtgtcga
     951  agccctccgt gttcttggcg ctaacatgga ggagagcggg gccggcgatc
    1001  tcttcgccta tgctgtcacc cgtggtatcc accgcgttgt aacagttgtt
    1051  agccacacgg atgagggtgg catccttcgt gacttactcc gtcacgatgc
    1101  attccgcgtc ccctacggtg gtattaatgc atccttgagg cactaccccg
    1151  ccctccccag tgcagcgggc tctcatgagt cctctatcgc agcgtgggty
    1201  gatggtatcg ccctcaagac tgccgccgtc gctgctcact gcgaccccct
    1251  cgtccccgga gtcggtggta tgtaccccac tgtcctcgtg gcgtcgaaag
    1301  ggtcgatatc cccgcctgga actccggagg gcgatgtctc gcccgacgac
    1351  gctcggtccc tcggtcgcca gctttctgcc gatatcggtc gtttcgcccc
    1401  caactatatc cggggactca gcgctctttt cggcctacaa ggctacaccg
    1451  caatagccga acggcacctg tgtgccacgg ctgggcacta ccttgaggag
    1501  aattcggcga caaaccggca tctcctccat aagaccatcg ctccatactt
    1551  ctgggtggag ccgacctccc tcatcccccg agatttccta ggtacttctg
    1601  cagagagcga gaactacgct gcaaaggtgt caccggggtg tgtagctcac
    1651  gagccccttt tcgagaagtt cgctccactc gcacagggga caactatgac
    1701  ctgtgcgaca gcgggtttca agatgaggac tgcgcggacg tccgggtatg
    1751  tgtgctcaca agccgctgcc cctgcatccc tggcgatgat ccagctgaag
    1801  cagttcgaca cacagtcggt tgtcttagct ggcgaccaag ggccaatatc
    1851  gggggacgtc gtcaccaagc accgcgcatc tagcccgctg tcctcctatt
    1901  tgtgggtccg gggccagagc gctctgccgg cccccgcaga gtttatcaat
    1951  acccagggct gctacggcgc aaaaatcaaa ctcgtcgatt ggacggatga
    2001  ttgggacccc gaatcgaccg acgtcccgcg gcctgatcag tttgccaccg
    2051  gtgttgttgc ttggcgtgtg tctctaccaa ccgggctacc gacgggcccc
    2101  agcaatgctg ccgatcggca agctcgacgc gccaggtcac gcggcgccat
    2151  cgccttagct caggcgttaa acagagcaag agcgttcggg gaaggagcgt
    2201  cgcctaccat ggaagtaagc gatgtccctc ccgatttggg tctggcggac
    2251  ttaggtcatt acgaccatac ggggttccgt gaacaccgtt ccgaccccgg
    2301  gaaagcgcag gagacagggg acggcaaccc ctcaccaacc cctacactcc
    2351  tgcgcggtgc tgctatgcca ccaactgagc agcacaagcc tcagggtgga
    2401  ccgcggctcc cggcaccccc accaaccatg gggcgcgccg ccggacccgt
    2451  cggaccccca tccacgccag cccctccccc ccccgcccca gttatcgccc
    2501  ctccgactgt cagtgatcct cctcccatgc ctgaggctgc caccggtgcc
    2551  gaaccggtgc cccaagcatg attgagtcca cagtggccga ccgcgccaac
    2601  gcagcgggct cggtgggccg atacctggaa gcgctgctcc cctcggaata
    2651  tacacgtgtc gtgtcgacac ttccattcga ccaccaagtt tcctttgttt
    2701  acaggccgtc gtggaggcat cataaaccca ccgaacttca gcgcgtggcc
    2751  gctgccttcc tacttccccg tgtacccgtg caggtgtcat acagcgcggg
    2801  ctctatactt actctcctca acgccacctt gcctaacctc ccccctaggc
    2851  atacttacca cgccgggtgg tcgtgtgata gcgacgcgac ccgcaaagcc
    2901  ttccccctga aggctaaccc cgccgcatcc aacaaagtca atgtttatct
    2951  ctctgaggta tgctacgact tgcgccgcac caatcctggt gaagctatgg
    3001  cggccgaggc agcacttcag cgggtccgtt cctcaggtag cgtatacaac
    3051  gaccaggcta cagctgtcgt tttgtacggc ttctgcttag ctcgcaacgg
    3101  cctgccgggg gcctatgata tcgcgctcgc cttgttactg aaccccgact
    3151  acgccaagtc actcaccggc gtcctcaagg caacgggcgg caatgcaacg
    3201  gctgtgggtt cactcctcgt ggaggccaac acactcctcg ggcgagacgt
    3251  cgcccctgtc gacctcggca aggagttcaa catgcgcaca cagctccgcc
    3301  tagcacgaga gaacatggcc gagtatcccc cggacgttct tcgggctaca
    3351  gtcaggcgcg tcctccttga cgagctgaca cggcgcgcag ggtcatatga
    3401  attagactac ccttcgttgg aggagcattg ggattcccgg tgggcatggg
    3451  ctgttaatgg cgcccaggga ggagcgatca ccgacaaggg gctcgaatcc
    3501  gctccccgtc cgcccggtgc aactcgggaa tatcgccgct cgtggctcga
    3551  acgagtggag gaggaccctc gcccccagtg ggacggcaca accgaagtgt
    3601  ctgcctcatc caaactcgag cacggtaaaa cacgcgccat cttcgcgtgt
    3651  gacaccgtta actaccttgc tttcgagcac ctcatgtcca ccgtcgaggc
    3701  caactggcgc ggcgtccggg tagttctcaa ccccgggaag ggcggtaaca
    3751  tggggatggc gatgcgtgtg caagctgctc ggaggcgatg cggtgtctcg
    3801  ctgatgctcg actacgatga cttcaattcg caccacacca taagtgcgat
    3851  gcaaatcgtt gtcgaagagg tttgttctat taccggatat gaccctgacc
    3901  tcgcggcccg gctggttgcc tccctcgaca agcagtacat cacactcgcg
    3951  ggacggcgga aactttctgt cggtaccctt atgagtgggc atcgatgtac
    4001  aacctttttc aactccgtcc tcaatgccgt ttacgtacgg cttgaattgg
    4051  gcgaaccgtt ctactcggag acagtgagcc tgcacgtcgg tgacgacgtg
    4101  tacatgggcg ttcgtgatta cgtttcggca gcgtacgtca tccaacgcct
    4151  agcggacagc cccctgagaa tgaacgctct taagcaatcc gtcgggcacg
    4201  tgtcgacgga gttcttacgt atcgcgaccg gcgctaggga ttgttacgga
    4251  tatctctcac gcgcggtcgc atcaattgtt agcgggaact gggtgaatga
    4301  caccgccctc gctcccttcg aagggctagc ggctatggtc gcttccgccc
    4351  gatccctcgc caatcgaggg aagacaaact tggcgcctct actgttggtg
    4401  tccagcgtgc tacgaatagc caagctgggc aagcgacact acggcaaggt
    4451  ctcttcacta ctcgatggca ccgtcgccct cggcaacgga ccacaatact
    4501  cctgcggcgc ccatatgcgc tggtgtaacc ctgtggtcgt acgcgatact
    4551  cccgacccct ggggttatac tgaactacct ctggagtcgg ttacggcata
    4601  cctctcgcgg gctgcatcgc ctttagagtg ggaggtcctc ggtgaggctg
    4651  gcatatctgt cacggaacaa atggctgcgg ctagttatcg taaaacttac
    4701  gcaagtctgt tctggcgcgg agagcgtctc accctgggcc caaccctatc
    4751  taaagcgccg atcggctcag cgagtgcgga agacttggcc cgtgcaacca
    4801  aaccacacgg tcttctcgca caataccctc ttttgctgct ggcgcgtgac
    4851  cgcataccgg agacactcgt acgcgtcgcg ctcggaaaag ctggcggcaa
    4901  cccacacaca tcgcacctag cgtatgatgc gtggggagag tatgatcacg
    4951  gctgccagat ccaaacggtc ttaggatacg cagatgccgc tgccttcggg
    5001  aagcggacga gtgctgatgt actcacatcg cggacactaa tgtacgtttg
    5051  atcccacacg acgtcaatcg tcgtgcattt atatccgggg ccattggccc
    5101  cagaaagca