Sequence of DPV Tomato yellow leaf curl China virus
Tomato yellow leaf curl China virus AV2 gene for pre-coat protein and partial AV1 gene for coat protein, isolate Y323
ACC No: AM261857
Dated: 2006-05-10 | Length: 519 | CRC: -760228789
ID AM261857 standard; genomic DNA; VRL; 519 BP. XX AC AM261857; XX SV AM261857.1 XX DT 10-MAY-2006 (Rel. 87, Created) DT 10-MAY-2006 (Rel. 87, Last updated, Version 1) XX DE Tomato yellow leaf curl China virus AV2 gene for pre-coat protein and DE partial AV1 gene for coat protein, isolate Y323 XX KW AV1 gene; AV2 gene; coat protein; pre-coat protein. XX OS Tomato yellow leaf curl China virus OC Viruses; ssDNA viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-519 RA Zhou X.; RT ; RL Submitted (06-MAY-2006) to the EMBL/GenBank/DDBJ databases. RL Zhou X., Zhejiang Universtity, Institute of Biotechnology, No.268, Kaixuan RL Road, Hangzhou, Zhejiang, 310029, CHINA. XX RN [2] RA Liao B., Zhou X.; RT "Rapid detection of geminiviruses infecting crops and weeds in Yunnan"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1. .519 FT /organism="Tomato yellow leaf curl China virus" FT /isolate="Y323" FT /mol_type="genomic DNA" FT /country="China:Yunnan" FT /isolation_source="Siegesbeckia orientalis" FT /virion FT /db_xref="taxon:185793" FT CDS 127. .483 FT /gene="AV2" FT /product="pre-coat protein" FT /protein_id="CAK12795.1" FT /translation="MLKMWDPLLNEFPETVHGFRCMLAIKFLQLVENTYSPDTLGYDLI FT RDLISVIRARDYGEASRRYSHFHSRLEGASPAELRQPLYGSCCCPHCPRHQKTNVVKQA FT HVSEAHDVPDVQKP" FT CDS 296. .>519 FT /gene="AV1" FT /product="coat protein" FT /protein_id="CAK12796.1" FT /translation="MAKRPADIVISTPASKVRRRLNFDSPYTGRAVAPTVRVTRRQMWS FT NRPMYRKPMMYRMYRSPDVPRGCEGPCKV" XX SQ Sequence 519 BP; 126 A; 126 C; 121 G; 146 T; 0 other; am261857 Length: 519 10-MAY-2006 Type: N Check: 6101 .. 1 taatattacc ggttggccgc gcgatttttt taaagtggtc cccatgtgcg 51 cgttcgtcca ataatatgcg ctcctcaaag cttagttatg aaatggtccc 101 ctataaaact tagtccccac gtatttatgt taaagatgtg ggatccattg 151 cttaatgagt tccctgaaac cgtgcacggt tttaggtgta tgttagcaat 201 taagtttttg cagttagtcg aaaatacata ctctcccgat acattaggtt 251 acgatttaat ccgtgattta atttcagtta tccgtgctag agactatggc 301 gaagcgtccc gccgatatag tcatttccac tcccgcctcg aaggtgcgtc 351 gccggctgaa cttcgacagc ccctatacgg gtcgtgctgt tgcccccact 401 gtccgcgtca ccagaagaca aatgtggtca aacaggccca tgtatcggaa 451 gcccatgatg taccggatgt acagaagccc tgatgttcca agggggtgtg 501 aagggccttg caaagtcca