Sequence of DPV Citrus tristeza virus

Citrus tristeza virus mRNA for coat protein (CP gene), isolate CTV-0036

ACC No: AM407894

Dated: 2008-01-08 | Length: 672 | CRC: 1923364045

                
ID   AM407894; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   AM407894;
XX
DT   08-JAN-2008 (Rel. 94, Created)
DT   08-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Citrus tristeza virus mRNA for coat protein (CP gene), isolate CTV-0036
XX
KW   coat protein; CP gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barbarossa L.;
RT   ;
RL   Submitted (11-OCT-2006) to the EMBL/GenBank/DDBJ databases.
RL   Barbarossa L., Dip. Protezione delle Piante e M.A., Istituto di Virologia
RL   Vegetale-Sez. Bari, Via Amendola 165/A, 70126 Bari, ITALY.
XX
RN   [2]
RA   Barbarossa L.;
RT   "Molecular characterization of CTV isolates from Italy";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus sinensis"
FT                   /cultivar="Naveline"
FT                   /isolate="CTV-0036"
FT                   /mol_type="mRNA"
FT                   /country="Italy:Apulia"
FT                   /virion
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAL59524.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 121 C; 170 G; 184 T; 0 other;

am407894 Length: 672  08-JAN-2008  Type: N  Check: 3984  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga