Sequence of DPV Citrus tristeza virus

Citrus tristeza virus mRNA for coat protein (CP gene), isolate CTV-0038

ACC No: AM407895

Dated: 2008-01-08 | Length: 672 | CRC: -1401044837

                
ID   AM407895; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   AM407895;
XX
DT   08-JAN-2008 (Rel. 94, Created)
DT   08-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Citrus tristeza virus mRNA for coat protein (CP gene), isolate CTV-0038
XX
KW   coat protein; CP gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barbarossa L.;
RT   ;
RL   Submitted (11-OCT-2006) to the EMBL/GenBank/DDBJ databases.
RL   Barbarossa L., Dip. Protezione delle Piante e M.A., Istituto di Virologia
RL   Vegetale-Sez. Bari, Via Amendola 165/A, 70126 Bari, ITALY.
XX
RN   [2]
RA   Barbarossa L.;
RT   "Molecular characterization of CTV isolates from Italy";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus sinensis"
FT                   /cultivar="Naveline"
FT                   /isolate="CTV-0038"
FT                   /mol_type="mRNA"
FT                   /country="Italy:Apulia"
FT                   /virion
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAL59525.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVATESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLFKKRGADEVVVTNVRQLGKLNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 122 C; 169 G; 182 T; 0 other;

am407895 Length: 672  08-JAN-2008  Type: N  Check: 3972  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcaa ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  tttaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaatta aacacacgtt ga