Sequence of DPV Botryotinia fuckeliana totivirus 1

Botryotinia fuckeliana totivirus 1, complete genome, genomic RNA

ACC No: AM491608

Dated: 2007-03-21 | Length: 5261 | CRC: 2087174788

                
ID   AM491608; SV 1; linear; genomic RNA; STD; VRL; 5261 BP.
XX
AC   AM491608;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   21-MAR-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Botryotinia fuckeliana totivirus 1, complete genome, genomic RNA
XX
KW   coat protein; complete genome; CP gene; RdRp gene;
KW   RNA-dependent RNA polymerase.
XX
OS   Botryotinia fuckeliana totivirus 1
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-5261
RA   De Guido M.A.;
RT   ;
RL   Submitted (31-JAN-2007) to the EMBL/GenBank/DDBJ databases.
RL   De Guido M.A., Plant Protection and Applied Microbiology, University of
RL   Bari, Bari, via Amendola 165/a, 70126, ITALY.
XX
RN   [2]
RA   De Guido M.A., Minafra A., Santomauro A., Pollastro S., De Miccolis R.M.,
RA   Faretra F.;
RT   "Molecular characterization of mycoviruses from Botryotinia fuckeliana";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5261
FT                   /organism="Botryotinia fuckeliana totivirus 1"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:425009"
FT   CDS             337. .2634
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAM33264.1"
FT                   /translation="MSSQLNPTFLSGVLANARGGRITTKDTYRRYKTIVRTSATIAGVL
FT                   DTRLTGIFYEIGRAVDTKGKLLKSHKEDITLVEASYPTNSVLAEDFIGMAKKYTNFSAS
FT                   FEYSSLAGVVERLGKGLAACSLFDSVTSTDLRGGAVLAVNALGTYDGPVNSLTDAVYIP
FT                   RLVNTTLTGDVFAVLCNAVAGEGSQVVSDVVELDANTRQPIIALVDSVGLPGAIVDALR
FT                   VLGSNMIASDQGPLFSLALARGLHRGLSLVGHTDEGSITRDLLRCGGFAPPFGGIHYGL
FT                   EPYVGLPALQTNLDKGVSAYVDAIVIATGAAVAHADPGTRFDGHWFPTFISGTASGEPL
FT                   LRPGEHTTGTTAMADRIRARLLADQSPFWEGYTRALSIIFGAEGDTSLSVRFACAASTA
FT                   LDVDNRHLKHASVSPWFWVEPTSILPPNLLGSEAELEGCASLAHKDTVVSKPAWDTITR
FT                   VGSSDVSFSAYRARFKFARQTWFFNHWLNHPMNGLGAMKVRQLDPNGIIHPGPCTAHPQ
FT                   VRDRVEADLPFTDYLWIRGQSPFPAPGELINLGLGVGFLVRHMTLDAEGIPNEEHLPTS
FT                   REIQDCVVTIDVGRPIGLASGKTNAADSQAKRARTRANNELAAARTRARVFGTPDVGEM
FT                   PTLTTAPGYATRWSSEQGIDSTSGGVVSRGRHDHAAPGHASGGDREPTGKQNIAVPQHQ
FT                   PLRYPALPRQGAGLGGGANPIPPPPAPPAGGPDDGPQSDDDNTPSAPTAPLGLSTTPPR
FT                   SPAAPGNGPDTI"
FT   CDS             2631. .5147
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /function="dsRNA replication"
FT                   /protein_id="CAM33265.1"
FT                   /translation="MSAADRASAYGRLGSYLKELLDDHPFVQGLFSTTNFTQSLIRLQG
FT                   SSFTMRSAHPLLPHAASLLLLDFPMQTDTSVSDVISLARNAYDLSDLGEDVLINHTLLP
FT                   PGSPILSWRRRGYHRKLGNAIITNKELRDSLFPKKKHNAAGVKVNLTIGRLAVAWARVF
FT                   GPGSLGRHLAAIAGRVTNDQACSALLYCLTLREHIGSFGISIAQAAVTQPANAKGLSNA
FT                   LKALGANSSLPGSLLVEAATLQGRFTNDVDMTNEIRSRTIQSLVDEQVIDRPEELRPHI
FT                   KALLEMSLPGDCALPDMDEWWSSRWLWCVNGSETKKSDEALGLRGGSGRRYRRMAAEEV
FT                   HSNPVPDWDGTTSVSASIKLEAGKDRAIFACDTRSYFAFSWILNDVQKKWKGERIPLDP
FT                   GKGGLYGISRRIRNSQRGGGVNLMLDYDNFNSHHSNSVQSMIFEVLCDKYNAPQWYKEV
FT                   LMESFNRMYIFKGGVRHRMLGTLASGHRGTSFINSLLNAAYIRCALGAAKFDTMLSLHA
FT                   GDDVYIRANTLSEAADILKKCKMFGCRMNPTKQSIGFRNAEFLRLGINSRYAVGYVART
FT                   ISTLVAGNWSNLDPMEPLESLTSVISSVRSVINRGAPTIIADVIAYAHSTLHPYPLKIL
FT                   KPLLRGEAAIAGAPIFNLHGKMRTYEAVVSKPDNSGNPPPPEWGSHATLSYLEYHVAPI
FT                   EASAISRARVDLTSIMQESSYAKQVRSDLDDASRRTTVKLIPRTPEEARGYIDASTLST
FT                   RDAKRGILESYPLIRLLENRLSDEDLRELALLLGVSCSTKEARVCCFGSESLTHNIIGY
FT                   LPYSDAASMSKTTNSRNIYTTYHVRA"
XX
SQ   Sequence 5261 BP; 1232 A; 1486 C; 1392 G; 1151 T; 0 other;

am491608 Length: 5261  21-MAR-2007  Type: N  Check: 3542  ..

       1  ccgaattccc gggatcctga aataagaggc accaatactt ccaatttggt
      51  gtgtcgacct cggtcgtcat ctcgtttcta cgggactgta tcgtacagac
     101  ccccgtactg gattgggaac caggagaacg ttcttctgta actctgccac
     151  gcatcccagc gtggcagggt acctcgttac tgtaaagtat cagactgggc
     201  cgaaagagga tgtgtaatta ttcggggagg gtgggccact gtgcctccgt
     251  tgatccaaat aaccaagcat tattacagcg gaaccgtatt tattaaacaa
     301  ccaacccaaa aatttgtaga acaacttttg tatacaatgt cttcccaact
     351  caatccaaca ttcctatctg gcgttctcgc caacgcacgt ggtgggcgta
     401  taaccaccaa agatacttat agacggtaca aaactatcgt cagaaccagc
     451  gcaactatcg ctggtgtcct ggatacccgt ttgacgggta tcttctatga
     501  aataggtcga gcagtcgaca ccaagggtaa gctccttaaa tcacacaagg
     551  aagacatcac ccttgttgag gcttcttacc caacaaattc cgtcctcgca
     601  gaggatttca ttgggatggc gaagaagtac actaacttct cagcctcctt
     651  tgagtactcc tcactggcag gagtggtcga aagactaggg aaagggcttg
     701  ctgcctgctc ccttttcgac tcggtcacgt caaccgattt gaggggtggt
     751  gccgtcctcg ctgtcaacgc gctcggcacc tatgacggcc cagtcaattc
     801  gctgactgac gccgtgtaca taccaaggct ggtaaacacc accttgacag
     851  gtgacgtctt cgcggtgtta tgtaacgccg ttgctggtga gggctcgcag
     901  gtcgtttctg acgtcgttga gctcgatgcc aacacccgcc aacccataat
     951  tgctttggta gatagtgttg ggctgcctgg tgcgatcgtg gatgccctca
    1001  gggtactcgg ctcgaacatg atcgcatccg accaggggcc gcttttttcc
    1051  ctcgccctcg ccagaggatt acaccgcggg ctctcccttg tcggacacac
    1101  cgatgagggg tccatcaccc gtgatctcct taggtgtggc gggtttgctc
    1151  ccccgttcgg tgggatacac tacggtctgg aaccgtacgt cgggctccca
    1201  gccctccaaa ccaatttgga caagggggta tcagcgtacg tcgatgctat
    1251  agtgatcgcc actggggcag cagtcgcaca cgccgaccct ggaacccgtt
    1301  tcgacggcca ctggttcccc acctttataa gtggaaccgc cagtggtgaa
    1351  ccgctcttgc ggccaggaga gcacacaacg ggtaccaccg ctatggccga
    1401  ccgcataagg gccagactct tggcggacca gtcgcctttc tgggagggat
    1451  acactcgagc cctctccatc atattcggtg cggagggaga cacatcgctt
    1501  tctgtgcgct tcgcctgtgc cgccagcact gcgctggacg tggacaaccg
    1551  gcaccttaag cacgcgtcag tgtctccttg gttctgggtg gaaccgacca
    1601  gcatcctacc ccccaaccta cttgggtcgg aagctgagct agaggggtgt
    1651  gcatcactgg cacacaaaga tacggtggtc tcaaaaccag cctgggacac
    1701  cattaccagg gtgggttcga gcgacgtgtc cttttccgcg tatcgcgcgc
    1751  gattcaagtt tgcccgccaa acttggttct ttaaccattg gctcaaccac
    1801  ccaatgaacg ggctcggtgc tatgaaggta cgacagcttg acccaaatgg
    1851  tatcatccat ccggggccct gtacggccca cccgcaggtg agagaccggg
    1901  tcgaggcgga cctacctttt actgactacc tctggatccg aggtcaatcg
    1951  cctttccccg ccccggggga gttaatcaac ctggggttgg gtgtgggctt
    2001  cttggtcagg cacatgacgt tagacgccga ggggattccc aatgaggaac
    2051  atctcccgac gtccagggaa attcaggact gcgtcgtgac gatagacgtc
    2101  ggtaggccta tcggactagc ctccgggaag actaacgctg cggacagcca
    2151  ggccaagcgc gcccgcaccc gcgctaacaa cgagctggcc gccgcccgta
    2201  cacgcgccag ggtgtttggt actcccgacg tcggagagat gccgaccctt
    2251  accacagctc ctggttacgc cacacgctgg agctccgaac aggggataga
    2301  ctcgacgagc gggggtgtcg tctctagagg ccgacacgac cacgctgcgc
    2351  cgggccacgc cagtgggggt gaccgggagc ctaccgggaa acagaacatt
    2401  gccgtccctc aacaccaacc actccgttac cctgcgctac ccaggcaagg
    2451  tgccggcctc ggcggtggag cgaatcctat tcccccaccc ccggcccccc
    2501  ctgctggtgg acctgatgat ggaccgcaat ctgacgacga caacactccc
    2551  tctgccccta ccgcacccct tggcctttcg actacccctc cgcgttcccc
    2601  tgctgcccca ggtaacgggc cggacacgat atgagtgcgg ccgacagggc
    2651  tagtgcgtac ggtaggctcg ggagctacct taaagaactt ctcgacgacc
    2701  accccttcgt acagggactc ttttctacta cgaactttac ccaatcgctg
    2751  atcaggctac agggtagttc gtttactatg cgttctgcgc acccactttt
    2801  gccacacgcg gcttctcttt tgttacttga ttttcctatg caaacagaca
    2851  cttccgtgtc cgatgtcatt agtctggccc gcaatgccta cgacttgtcc
    2901  gacctcggtg aggatgtgct gattaaccac actcttttgc cccccggttc
    2951  cccgatactc tcttggagga ggaggggcta ccaccgaaag ctaggtaacg
    3001  ctataattac caacaaggag cttagggact ccctcttccc taagaagaaa
    3051  cataacgcag ccggtgttaa ggtaaacttg acaattggga ggctggcggt
    3101  ggcatgggcc agggtctttg gcccaggctc actgggcagg catctagctg
    3151  ccatcgcagg tagggtgacc aatgaccaag cctgctcggc cttgttgtac
    3201  tgtctaaccc ttcgggagca tattggttct tttggcatat caatagccca
    3251  ggccgctgtc acacagccgg caaatgcaaa aggactatct aacgctctga
    3301  aggctctggg tgccaattcc tctcttcccg gatccttact cgtcgaagct
    3351  gccacactac aaggtcgttt caccaacgac gtcgatatga ctaatgaaat
    3401  aaggtcgcgc acgatacaat cgttagtgga cgaacaggtc atcgacagac
    3451  cagaggagtt gcgcccccac atcaaggcgc tattggagat gtcactccct
    3501  ggcgattgcg cactcccaga tatggacgag tggtggtcgt cgaggtggct
    3551  gtggtgtgtc aacggttcag aaaccaagaa gtcagacgag gctctaggtt
    3601  tgaggggggg gagtggccgc cgctacagac gcatggctgc agaggaggta
    3651  cacagcaacc cagtaccaga ctgggacggc acaacttcgg tatcagcgag
    3701  tatcaagctc gaggcaggta aggatcgcgc aatcttcgct tgcgacaccc
    3751  gttcttactt cgcgttctcg tggatactca atgacgtgca aaagaagtgg
    3801  aagggggaga ggatcccttt ggatccaggg aaaggcggac tgtacggtat
    3851  ctcacgccga atccgtaaca gtcagagagg aggtggagtc aatttgatgc
    3901  ttgactacga caactttaac tcgcatcact ccaacagcgt ccagagtatg
    3951  atcttcgaag tactctgcga caaatacaac gcacctcagt ggtacaagga
    4001  ggtgttgatg gaatccttca acaggatgta cattttcaag gggggggtga
    4051  gacaccgtat gttaggcacg ctggcaagcg ggcacagagg gacatcattc
    4101  attaactccc tcctgaacgc agcttacatt cggtgtgctc ttggggctgc
    4151  aaagttcgac actatgctga gcttgcacgc gggggacgac gtatatatcc
    4201  gcgccaacac gctgagtgaa gcggcggata tcctgaagaa atgtaagatg
    4251  tttggatgta ggatgaatcc cacgaagcag agtattggat tcaggaatgc
    4301  agaattctta aggttaggaa ttaactctcg ttacgccgta gggtatgtgg
    4351  ccagaaccat atcgacccta gtggcaggaa attggtctaa cctagacccc
    4401  atggaacccc ttgagtcctt gacttcagtc atatcctcag tacgtagtgt
    4451  aatcaaccgg ggcgcgccga ctataatagc cgacgtcata gcctacgctc
    4501  attctacttt acacccgtac ccactgaaga tcctcaaacc gttactcagg
    4551  ggggaggcgg ccatcgcagg tgcaccaatt ttcaacctgc atggaaagat
    4601  gaggacttac gaagctgtcg taagtaaacc tgacaattca ggcaaccccc
    4651  caccacctga gtgggggtca catgccaccc ttagctacct agaataccac
    4701  gtagcgccaa tcgaagcctc tgccattagt agggcaaggg tcgatctcac
    4751  gtcaatcatg caggaatcga gctatgcgaa acaagttcgc agcgacctgg
    4801  atgacgcgtc gagacgtacc actgttaaat taatcccgag gaccccagaa
    4851  gaagcgcgcg gatatataga cgcatctacc ctttcaacca gggatgcgaa
    4901  aagaggtatt ctagaaagct atccacttat tcggttactc gagaaccgtc
    4951  tgagcgacga agaccttcgg gaactcgcac ttctccttgg agtatcatgc
    5001  tccactaaag aagcgagagt ctgctgcttt gggtctgagt cacttactca
    5051  taacatcata gggtatctac cctacagtga tgctgcgtct atgagtaaga
    5101  ccaccaactc gagaaacatc tacacaacat accacgttag agcttaacgt
    5151  gatggccgga tagacgaccg gttttaaacg cactatgtgc gcacacttat
    5201  tggcccgcaa gggctaaaat gccgttagga attaactctc attacgccgt
    5251  agggtatgtg g