Sequence of DPV Tomato yellow leaf curl virus
Tomato yellow leaf curl virus-Mild Mp gene for movement protein and partial CP gene for coat protein, isolated from Petite ile, Reunion, isolate 04_2
ACC No: AM498127
Dated: 2007-08-03 | Length: 436 | CRC: -968326849
ID AM498127; SV 1; linear; genomic DNA; STD; VRL; 436 BP. XX AC AM498127; XX DT 21-MAR-2007 (Rel. 91, Created) DT 03-AUG-2007 (Rel. 92, Last updated, Version 2) XX DE Tomato yellow leaf curl virus-Mild Mp gene for movement protein and partial DE CP gene for coat protein, isolated from Petite ile, Reunion, isolate 04_2 XX KW coat protein; CP gene; movement protein; Mp gene. XX OS Tomato yellow leaf curl virus-Mild OC Viruses; ssDNA viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-436 RA Delatte H.; RT ; RL Submitted (21-FEB-2007) to the EMBL/GenBank/DDBJ databases. RL Delatte H., Plant Protection, Cirad, 7, chemin de l'IRAT, 97410 Saint RL Pierre, REUNION. XX RN [2] RA Delatte H., Holota H., Moury B., Reynaud B., Lett J.M., Peterschmitt M.; RT "Evidence for a Founder Effect After Introduction of Tomato Yellow Leaf RT Curl Virus-Mild in an Insular Environment"; RL J. Mol. Evol. 65(1):112-118(2007). XX FH Key Location/Qualifiers FH FT source 1. .436 FT /organism="Tomato yellow leaf curl virus-Mild" FT /isolate="04_2" FT /mol_type="genomic DNA" FT /country="Reunion:Petite ile" FT /collection_date="2000" FT /identified_by="Delatte Helene" FT /virion FT /db_xref="taxon:220944" FT CDS 81. .431 FT /gene="Mp" FT /product="movement protein" FT /db_xref="UniProtKB/TrEMBL:A4FSU6" FT /protein_id="CAM57009.1" FT /translation="MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDL FT ISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDLQAHV FT PEAQNIQNVSKP" FT CDS 241. .>435 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:A4FSV9" FT /db_xref="UniProtKB/TrEMBL:A4FSV9" FT /protein_id="CAM57010.1" FT /translation="MSKRPGDIIISTPASKVRRRLNFDSPYSSRAAVPIVQGTNKRRSW FT TYRPMYRKPRIYRMYRSPDV" XX SQ Sequence 436 BP; 117 A; 102 C; 93 G; 124 T; 0 other; am498127 Length: 436 03-AUG-2007 Type: N Check: 9657 .. 1 aatcaaattg catccttaaa cgttagataa gtgttcattt gtctttatat 51 acttggtccc caagtagttt gtcttgcaat atgtgggatc cacttctaaa 101 tgaatttcct gaatctgttc acggatttcg ttgtatgtta gctattaaat 151 atttgcagtc cgttgaggaa acttacgagc ccaatacatt gggccacgat 201 ttaattaggg atcttatatc tgttgtaagg gcccgtgact atgtcgaagc 251 gaccaggcga tataatcatt tccacgcccg cctcgaaggt tcgccgaagg 301 ctgaacttcg acagcccata cagcagccgt gctgctgtcc ccattgtcca 351 aggcacaaac aagcgacgat catggactta caggcccatg taccggaagc 401 ccagaatata cagaatgtat cgaagccctg atgttc