Sequence of DPV Eggplant mottled crinkle virus

Lisianthus necrotic virus, genomic RNA, strain Zantedeschia

ACC No: AM711119

Dated: 2008-10-16 | Length: 4764 | CRC: -476983500

                
ID   AM711119; SV 2; linear; genomic RNA; STD; VRL; 4764 BP.
XX
AC   AM711119;
XX
DT   17-AUG-2007 (Rel. 92, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Lisianthus necrotic virus, genomic RNA, strain Zantedeschia
XX
KW   coat protein; movement protein; MP gene; ORF5; p19 gene; p19 protein;
KW   replicase gene; RNA-dependent RNA polymerase.
XX
OS   Lisianthus necrosis virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RC   revised by [3]
RA   Chang Y.S.;
RT   ;
RL   Submitted (04-MAY-2007) to the EMBL/GenBank/DDBJ databases.
RL   Chang Y.S., Plant Pathology, National Chung Hsing University, 250, Kuo
RL   Kuang Rd., Taichung 402, R.O.C, TAIWAN.
XX
RN   [2]
RA   Chang Y.S., Chen Y.K.;
RT   "Molecular diagnosis of Lisianthus necrosis virus Zantedeschia strain";
RL   Unpublished.
XX
RN   [3]
RP   1-4764
RA   Chang Y.S.;
RT   ;
RL   Submitted (16-OCT-2008) to the EMBL/GenBank/DDBJ databases.
RL   Chang Y.S., Plant Pathology, National Chung Hsing University, 250, Kuo
RL   Kuang Rd., Taichung 402, R.O.C, TAIWAN.
XX
DR   RFAM; RF00171; Tombus_5.
DR   RFAM; RF00176; Tombus_3_IV.
DR   RFAM; RF00510; Tombus_IRE.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4764
FT                   /organism="Lisianthus necrosis virus"
FT                   /specific_host="Zantedeschia jucunda"
FT                   /strain="Zantedeschia"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /db_xref="taxon:334425"
FT   CDS             join(165. .1052,1056. .2621)
FT                   /ribosomal_slippage
FT                   /gene="replicase"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="readthrough protein"
FT                   /db_xref="GOA:A7M8Y0"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:A7M8Y0"
FT                   /protein_id="CAM98052.1"
FT                   /translation="MDRLLNFLRPKKEIFVGDFAIGVDRRPSMDMFQLVCRLALRYMRT
FT                   GKIECNVDSLSQFVVELLKTDCAAKWEWFMKRRSAGDYAIPLALAALPIAPLLGYATKV
FT                   RTVSVKAFGNELTFPFRTLRPSFPRKGLLLRLAAGLALAPVCALAVYATLPREKLSVFR
FT                   LRTEARTHMEDEREATECLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   VAQVARAKVGYLKNSPENRLIYQRVIIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVKGGLVRLPGVVTQTNRDIPSGVLLPQEVLEVRTGPPNAKDRSIFM
FT                   VAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGILTRTPQPAKGAFSRLSPFRKAVC
FT                   EKVGVAHRLGYDGFLSYYSGAKLRTYTRAVESLHISPVCERDSHLTTFVKAEKISTSKG
FT                   DPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGQIFRDKW
FT                   DKFDRPVAIGLDASRFDQHCSVEALQFEHSFYRAMYPGNKLLSKLLEWQLHNKGKGYVP
FT                   DGTITYRKEGCRMSGDINTSLGNYLLMCAMIYGYMRHLGINEYSPANCGDDCTLIVERK
FT                   HLKRIQGTLPEYFLNLGYTMKVEPPVFQLEEVEFCQAHPVQFEGGWKMVRNVRTAMSKD
FT                   VHCVNNIKDLATRKAWSNAQHHGGIALSAGIPVVEKFYSRFALYEMPKRHQRIDTVTNV
FT                   HKWRGSGGKYSVTPESRASFWQAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSIL
FT                   DSAVA"
FT   CDS             <165. .1055
FT                   /codon_start=1
FT                   /gene="replicase"
FT                   /product="33-kDa protein"
FT                   /function="essential for virus replication"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:A7M8Y1"
FT                   /protein_id="CAM98053.1"
FT                   /translation="MDRLLNFLRPKKEIFVGDFAIGVDRRPSMDMFQLVCRLALRYMRT
FT                   GKIECNVDSLSQFVVELLKTDCAAKWEWFMKRRSAGDYAIPLALAALPIAPLLGYATKV
FT                   RTVSVKAFGNELTFPFRTLRPSFPRKGLLLRLAAGLALAPVCALAVYATLPREKLSVFR
FT                   LRTEARTHMEDEREATECLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   VAQVARAKVGYLKNSPENRLIYQRVIIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVK"
FT   CDS             2647. .3813
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:A7M8Y2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A7M8Y2"
FT                   /protein_id="CAM98054.1"
FT                   /translation="MEIVRRNNNNAIAINKKQLASMAATAAAGALSNYVKNNGAMIVQG
FT                   AVNMGKKAYGAVRNRRNKGNSQAMVHVGGMGGAMMAPVAVSRQLVGSKPKFAGRTAGSV
FT                   TVTHREYLTQVNNSPAFTTNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYVFNSVMLH
FT                   YVPLCGTNEVGRVAMYWDKDSEDPEPVDRVELANFGILKETAPWAEAILRVPTDKTKRY
FT                   CDDSTVVDRKLIDLGQLGISTYGGTGTNPVGDVFVSYSVTLYFPQPTNTLLSTRQLNLT
FT                   GALEASTGPGYINVTRTPTLLTITFRSTGTFLLSGVFRDTSVAVLGVAGGIGINSQTTL
FT                   DVVGVATSFLVNCTVSTLPATLTYGSAGITSVTANCTRATRANTATLL"
FT   CDS             3845. .4420
FT                   /gene="MP"
FT                   /product="movement protein"
FT                   /db_xref="GOA:A7M8Y3"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProtKB/TrEMBL:A7M8Y3"
FT                   /protein_id="CAM98055.1"
FT                   /translation="MDTEYEQVNKPWNELYKEATLGNKLTVNVGMEDVEVPLLPSNFLT
FT                   KVRVSLSGGYITVRRVRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTELLDLGKEI
FT                   RLTMQHLDFSVSARSDVPIVFGFEDLVSPFLEGRELFSVSLRWQFGLSAQCYSLPPAKW
FT                   KVMYQEEALKALKPSKKKASKTDSSRLE"
FT   CDS             3877. .4395
FT                   /gene="p19"
FT                   /product="p19 protein"
FT                   /db_xref="GOA:A7M8Y4"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProtKB/TrEMBL:A7M8Y4"
FT                   /protein_id="CAM98056.1"
FT                   /translation="MERAIQGSDAREQAYSERWDGGCGGTITPFKLPDESPSLIEWRLH
FT                   NSEESEDKDNPLGFKESWSFGKVVFKRYLRYDGTEASLHRALGSWERDTVNDAASRFLG
FT                   FGQIGCTYCIRFRGSCLTISGGSRTLQRLIEMAIRTKRTMLQLAPCEVEGNVSRGSPEG
FT                   TEAFKEESE"
FT   CDS             4594. .4713
FT                   /product="hypothetical protein"
FT                   /note="ORF5"
FT                   /db_xref="UniProtKB/TrEMBL:A7M8Y5"
FT                   /protein_id="CAM98057.1"
FT                   /translation="MPSRLCGMSLTLIGCQFSTGVAATEQHFEHGWSHPSGGL"
XX
SQ   Sequence 4764 BP; 1212 A; 1022 C; 1335 G; 1195 T; 0 other;

am711119 Length: 4764  16-OCT-2008  Type: N  Check: 1511  ..

       1  agaaattcct cagatttctc cctgtgaccc ggggttatcg gtgagttgcg
      51  cttgtgcttt gcgtaaggga tttctctcgt acgggtacga tctacggacc
     101  agctacgggt ttgaagggcg ggcctattct tcggaagggt aaattgtaac
     151  ttccgccaat aagcatggat agattactga actttctgag acctaagaag
     201  gaaattttcg taggtgattt tgcgatcggg gttgacagga ggccatcgat
     251  ggacatgttc caattggtgt gtaggttggc tctcagatat atgaggacag
     301  ggaaaatcga gtgtaatgtg gacagtcttt cacagttcgt tgttgagttg
     351  ttaaagactg attgtgcagc caagtgggaa tggttcatga aacggcgttc
     401  cgccggtgat tacgctatcc ctcttgcact ggctgcactg cccattgctc
     451  cgctgttggg ctatgccacg aaggttagaa cggtgagtgt aaaggcgttc
     501  gggaatgaat tgactttccc attcaggacc cttcgcccaa gcttcccccg
     551  taagggcttg ctccttcggc tggcggccgg ccttgcgtta gcacctgtat
     601  gcgcgcttgc tgtgtacgct accctaccac gggaaaaact gtctgtattt
     651  aggctgagaa cagaagcccg cacacatatg gaggatgaga gggaagcaac
     701  ggaatgtttg gtggttgagc cagctcgaga gctcaagggg aaggacgggg
     751  aggatctcct cactggtagt agaatgacga aggtaattgc gtctacggga
     801  cgccctcgca ggagacctta tgcagctaaa gttgctcagg ttgcaagagc
     851  taaggtgggt taccttaaga atagtcctga gaatagatta atctaccaga
     901  gagtcattat tgagatcatg gacaaggatt gcgtcaggta tgttgacagg
     951  gatgtcatat tgcctttagc tattggatgt tgttttgtct acccggacgg
    1001  agtggaggag tcggcggcac tctggggctc tagtgagtcc ctgggtgtga
    1051  aatagggagg cctagtgcgt ctacctgggg ttgtgacaca gaccaatcga
    1101  gatatcccat ctggtgtgtt acttccccag gaagtgctag aggttcgcac
    1151  aggacctccc aatgctaagg accgtagtat attcatggtt gctggttgcc
    1201  catcacaggc acggttctta gttcataatc attgcctgaa aaaccttaag
    1251  aggggtcttg tggagagagt tttctgtgtt gagagaaatg gaattctcac
    1301  tcgcactcca caacctgcca aaggagcctt tagtcgtctt tccccgttca
    1351  ggaaagcggt ttgtgagaag gtcggagttg cccaccgtct tgggtatgat
    1401  gggtttctat catactacag cggtgcgaag ctgcgtactt acacgcgagc
    1451  cgtggagagt ctgcatatct cccccgtctg tgagagggac agtcatttga
    1501  ctaccttcgt caaggcggag aagatatcga cgtctaaggg tgacccagcg
    1551  cctagggtga tacagcctcg taaccctagg tacaatgtgg aacttggaag
    1601  atatctgcgg catatggagt ccaagctgat gaaagcggta gatggcgtgt
    1651  ttggtgaaac gacatgcatt aagggctaca ccgctgatga ggtggggcag
    1701  atctttaggg acaagtggga caaatttgat cgtccagtcg ctattggtct
    1751  tgatgcctca cggtttgatc aacactgttc ggttgaagcg ttgcaatttg
    1801  agcatagctt ctacagggcc atgtaccctg gcaacaagct cttgagcaag
    1851  ttgctcgaat ggcaactcca caataagggg aaaggatatg tgcctgatgg
    1901  cactattacc tatcgtaagg agggttgtcg catgagtggg gatataaaca
    1951  catcacttgg taattacctg ttaatgtgtg ccatgattta tggttatatg
    2001  cgccatttgg ggatcaatga gtatagtccg gcgaactgtg gggatgattg
    2051  cactctcatt gtggaacgca agcatcttaa acggatacaa ggtacactac
    2101  ccgagtattt cctaaatctg ggttatacta tgaaggtgga accccctgta
    2151  tttcaattgg aggaggttga attctgccag gcacacccag tacagtttga
    2201  aggtggttgg aagatggtcc ggaatgtccg taccgctatg agcaaggatg
    2251  tacactgtgt caacaatatt aaagatctgg ctacacgcaa ggcgtggagt
    2301  aatgcacaac accatggtgg catagcactt agtgctggca tacccgtggt
    2351  tgagaagttt tactcccggt tcgctttgta tgagatgcca aagaggcacc
    2401  aaagaattga cacagtcaca aacgtgcaca agtggcgtgg atcgggtgga
    2451  aagtatagtg tgacccctga gtcaagggca agcttttggc aagcctttgg
    2501  cctgacgggg gatgagcagc ttgctttaga ggaccgtctg gatagatggg
    2551  agatggacct atttggagag gagggtgttg acgctcatga gcccagcatc
    2601  cttgactccg ccgtagcttg accaagtgaa cacaagcgac atagcaatgg
    2651  aaatcgttag gagaaacaat aataatgcaa tcgcgatcaa taagaaacag
    2701  ctggcctcta tggcggctac tgccgccgct ggggctctga gcaattatgt
    2751  gaagaacaat ggagcaatga ttgtacaagg tgcggtgaat atgggcaaga
    2801  aagcttatgg agcagtaagg aatcgtagga ataagggtaa ttcacaggcg
    2851  atggtgcacg taggtggtat gggcggggct atgatggccc ctgtggcagt
    2901  atcccggcaa cttgtgggca gtaagccaaa gttcgcaggt aggactgctg
    2951  gatcagtcac agtcacccac cgtgagtact taacccaggt gaacaactcc
    3001  cctgctttta caaccaatgg aggtattgtc gggaatttgt tacaactcaa
    3051  cccgcttaat ggcacactgt tttcgtggtt accggctatc gcgtcgaact
    3101  tcgatcagta cgtctttaac agcgttatgt tgcattatgt ccccctctgt
    3151  ggcacaaatg aagtagggcg tgttgcaatg tactgggata aggactctga
    3201  ggatcctgag cctgtggata gagtggaatt agctaatttc ggtatactta
    3251  aagagacggc cccatgggcc gaagctattc tgagggtccc aactgataag
    3301  acgaaacgat actgcgatga cagtacagtg gttgacagga agcttatcga
    3351  cctcggacag ctcggaatat ctacatatgg agggaccgga actaatcctg
    3401  tgggggatgt gtttgtgtcg tatagcgtta cgctttactt cccacaaccc
    3451  acgaataccc tactcagcac acgacagctt aaccttactg gcgccctaga
    3501  agcatctact gggcccggat atattaacgt aacacgtaca ccaacgctct
    3551  tgacaataac attcaggtct accggaactt tcctgctttc gggggttttc
    3601  cgggatacta gtgttgctgt tcttggtgtg gcggggggca taggaattaa
    3651  tagtcagacc acacttgatg ttgttggcgt agccacatca ttccttgtga
    3701  actgtacagt gtccacacta cccgctacac tcacatatgg atctgctggg
    3751  ataacatctg tcactgcgaa ttgcacacgg gccacaaggg ccaacaccgc
    3801  aacattgcta tagtcgcctc ggggcctctt gaacagacca gtttatggat
    3851  actgaatacg aacaagtcaa taaaccatgg aacgagctat acaaggaagc
    3901  gacgctaggg aacaagctta cagtgaacgt tgggatggag gatgtggagg
    3951  taccattact cccttcaaac ttcctgacga aagtccgagt ctcattgagt
    4001  ggaggctaca taacagtgag gagagtgagg ataaagataa tccccttggt
    4051  ttcaaggaaa gctggagttt cgggaaagtt gtatttaaga gatatctcag
    4101  atacgacggg acggaagctt cattgcacag agctcttgga tcttgggaaa
    4151  gagatacggt taacgatgca gcatctagat ttctcggttt cggccagatc
    4201  ggatgtacct attgtattcg gtttcgagga tcttgtctca ccatttctgg
    4251  agggtcgcga actcttcagc gtctcattga gatggcaatt cggactaagc
    4301  gcacaatgtt acagcttgcc ccctgcgaag tggaaggtaa tgtatcaaga
    4351  ggaagccctg aaggcactga agccttcaaa gaagaaagcg agtaagacag
    4401  actcttcacg cttggagtga agtttggtgg cagctataca ccttagacta
    4451  ctggttacta ctgtcaggtc ggaacccaca ctaattgagc taggtcgggc
    4501  cccgtcgtag gtttggtcac ctacggaatg gggatatgga aaggatctcg
    4551  taccctgtga gtcaaacgaa agttgtgctt gggatatggg tctatgccta
    4601  gtaggttatg tggtatgtct ctgactttaa ttggatgcca gttttcaaca
    4651  ggagtggcag cgactgaaca acactttgag cacggttggt ctcacccttc
    4701  gggggggcta tagagatcac cggaagcact accggacaac cggaacattg
    4751  cagaaatgca gccc