Sequence of DPV Citrus tristeza virus

Citrus tristeza virus cp gene for coat protein, genomic RNA, isolate CTV-G74

ACC No: AM746969

Dated: 2008-01-08 | Length: 672 | CRC: 1530017021

                
ID   AM746969; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AM746969;
XX
DT   08-JAN-2008 (Rel. 94, Created)
DT   08-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Citrus tristeza virus cp gene for coat protein, genomic RNA, isolate
DE   CTV-G74
XX
KW   coat protein; cp gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barbarossa L.;
RT   ;
RL   Submitted (12-JUN-2007) to the EMBL/GenBank/DDBJ databases.
RL   Barbarossa L., Dip.Protezione Delle Piante E M.A., Istituto Di Virologia
RL   Vegetale-Sez. Bari, Via Amendola 165/A, 70126 Bari, ITALY.
XX
RN   [2]
RA   Barbarossa L.;
RT   "A preliminary survey of virus and virus-like diseases of Citrus in Epirus
RT   (Greece). Unpublished.";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CTV-G74"
FT                   /mol_type="genomic RNA"
FT                   /country="Greece"
FT                   /isolation_source="Citrus sinensis"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAN90156.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSLGSVNLHIDPTLITMNDV
FT                   CQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTNIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 121 C; 170 G; 184 T; 0 other;

am746969 Length: 672  08-JAN-2008  Type: N  Check: 3891  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tctcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgtgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc aacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga