Sequence of DPV Pelargonium line pattern virus

Pelargonium line pattern virus putative coat protein (CP) gene, complete cds.

ACC No: AY038067

Dated: 2009-01-10 | Length: 1017 | CRC: -528483599

                
ID   AY038067; SV 1; linear; genomic RNA; STD; VRL; 1017 BP.
XX
AC   AY038067;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   10-JAN-2009 (Rel. 98, Last updated, Version 2)
XX
DE   Pelargonium line pattern virus putative coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Pelargonium line pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1017
RA   Kinard G., Guaragna M.A., Jordan R.;
RT   "Characterization and genome organization of four unique viruses infecting
RT   geranium and their assignment to a new provisional genus in the
RT   Tombusviridae family (#VP64.13)";
RL   (in) Unknown A. (Eds.);
RL   XITH INTERNATIONAL CONGRESS OF VIROLOGY:415-415;
RL   Unknown Publisher (1999)
XX
RN   [2]
RP   1-1017
RA   Jordan R.;
RT   ;
RL   Submitted (05-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Floral & Nursery Plants Research Unit, USDA, ARS, US National Arboretum,
RL   10300 Baltimore Ave, Bldg 010A, Room 238, Beltsville, MD 20705, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1017
FT                   /organism="Pelargonium line pattern virus"
FT                   /isolate="CF"
FT                   /mol_type="genomic RNA"
FT                   /note="PLPV-CF"
FT                   /db_xref="taxon:167019"
FT   gene            1. .1017
FT                   /gene="CP"
FT   CDS             1. .1017
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="putative coat protein"
FT                   /db_xref="GOA:Q911J6"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q911J6"
FT                   /protein_id="AAK74062.1"
FT                   /translation="MAAKDNPAVIAAVARREQWAIKLQSKGWGSLSKAQKATARSYGIG
FT                   NPPTVVVPRTTRLVAGNPTNARRARGEPGNAKMGTTITKQEYMGELHSSSKIETYLLDP
FT                   KNVRSFPQLSGLAIGYNKYKITDFKVRYSPKCSDSGCGLTIAYSSDSSDPPPKNKFNLF
FT                   SMNHKYETAAHKPLLVTLPVSKETRFLRDKCTDDSKLVDSGAVHVLVDGNHEGRLGELF
FT                   FELTIVFSEPTFCNHHSQVIKGIKESEGPEYVKVEPDKETVKLVFQAAGAYLVSIVASK
FT                   LERIGQLGASEGDKQVVESADKSACLCRIEAEQPGSAIVLVYASREAITLRAYINKL"
XX
SQ   Sequence 1017 BP; 277 A; 252 C; 277 G; 211 T; 0 other;

ay038067 Length: 1017  10-JAN-2009  Type: N  Check: 8603  ..

       1  atggcggcca aggataatcc ggcagtcatc gcagccgtgg caagacggga
      51  gcagtgggca attaagcttc aatccaaagg ttggggctct ttgtccaaag
     101  cccagaaagc cactgcacgc tcgtacggga tagggaaccc tccaacagtc
     151  gtggtgcctc gcaccactcg gctggtggca gggaacccca cgaacgcacg
     201  gcgtgcgcgg ggggagcctg gtaatgccaa gatgggcacc accataacca
     251  agcaggaata catgggcgag cttcattctt cttcaaagat tgaaacttac
     301  ttgctcgacc ccaagaatgt gaggagcttc cctcagttaa gcgggcttgc
     351  aatcggctac aacaagtaca agatcactga cttcaaggtg cggtacagtc
     401  ctaaatgcag cgacagtggg tgtgggttga ccattgccta ctctagcgac
     451  tcatctgatc caccgccgaa gaacaaattc aacttgttta gcatgaacca
     501  caagtatgaa acagccgcgc acaagccact cctagtaaca cttcccgtat
     551  ctaaagagac cagattcttg cgggataagt gcactgatga ttccaagctc
     601  gtagacagtg gggcggtgca tgtcctggtg gacgggaacc acgaaggtag
     651  gctcggagaa cttttcttcg agttaactat cgtgttctct gaaccaacct
     701  tttgcaatca ccactcccaa gtcattaagg gaatcaagga gagtgaaggg
     751  cccgaatacg tcaaagttga gcctgacaag gaaaccgtga aactagtttt
     801  ccaggcagcg ggggcatact tagtgtctat agtagcctcc aaactagagc
     851  gaatcgggca gctcggtgct tctgaaggtg acaagcaggt agtagagagt
     901  gctgataaga gtgcctgcct ctgtaggata gaggcggagc aaccaggtag
     951  tgctatagta ttagtttatg ccagcaggga ggccattacc ctgcgagctt
    1001  acatcaacaa gctatga