Sequence of DPV Eggplant mottled crinkle virus

Pear latent virus 33 kDa RNA polymerase pre-readthrough protein, 92 kDa RNA polymerase, coat protein CP, 22 kDa movement protein, and 19 kDa symptom severity modulator genes, complete cds.

ACC No: AY100482

Dated: 2005-04-16 | Length: 4766 | CRC: 882513922

                !!NA_SEQUENCE 1.0
ID   AY100482   standard; genomic RNA; VRL; 4766 BP.
XX
AC   AY100482;
XX
SV   AY100482.1
XX
DT   16-JUN-2002 (Rel. 72, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Pear latent virus 33 kDa RNA polymerase pre-readthrough protein, 92 kDa RNA
DE   polymerase, coat protein CP, 22 kDa movement protein, and 19 kDa symptom
DE   severity modulator genes, complete cds.
XX
KW   .
XX
OS   Pear latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4766
RA   Russo M., Vovlas C., Rubino L., Grieco F., Martelli G.P.;
RT   "Molecular characterization of a tombusvirus isolated from diseased pear
RT   trees in southern Italy";
RL   J. Plant Pathol. 84:161-166(2002).
XX
RN   [2]
RP   1-4766
RA   Russo M.;
RT   ;
RL   Submitted (30-APR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Istituto di Virologia Vegetale-Sezione di Bari, Consiglio Nazionale Delle
RL   Ricerche, Via Amendola 165/A, Bari 70126, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4766
FT                   /db_xref="taxon:197112"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pear latent virus"
FT   CDS             167. .2623
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMT5"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q8JMT5"
FT                   /transl_except=(pos:1055. .1057,aa:Glx)
FT                   /product="92 kDa RNA polymerase"
FT                   /protein_id="AAM49803.1"
FT                   /translation="MDRLLNFLRPKRELFVGDFAIGVDRRPSVDMFQLVCRLALRYMRT
FT                   GKIECNVDSLQQFVVELLKTDCAAKWEWFMKRRSAGDYAIPLALAALPIAPLLSYTTKV
FT                   RTVSVKAFGNELTFPFRTLRPSLPRKGLLLRLAAGFALAPVCLLAVYATLPREKLSVFR
FT                   LRTEARTHMEDEREATECLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   VAQVARAKVGYLKNSPENRLIYQRVIIEIMDKDCVRYIDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVKZGGLVRLPGVVTQTNRDIPSGVLLPQEVLEVRTGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVEKNGILTRTPQPAKGAFSRLSPFRKAV
FT                   CEKVGVAHRFGYDGFLSYYNGAKLRTYTRAVESLHISPVCERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGQIFRDK
FT                   WDKFDRPVAIGLDASRFDQHCSVEALQFEHSFYRAMYPGNKLLSKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMIYGYMRHLGINEFSLANCGDDCVLIVER
FT                   KHLKRIQGTLPEYFLNLGYTMKVEPPVFQLEEVEFCQAHPVQFEGGWKMVRNVRTAMSK
FT                   DVHCVNNIKDLATRKAWSNAQHHGGIALSAGIPVVEKFYSRFALYEMPKRHQRIDTVTN
FT                   VHKWRGSGGKYSVTPESRASFWQAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8JMT4"
FT                   /product="33 kDa RNA polymerase pre-readthrough protein"
FT                   /protein_id="AAM49802.1"
FT                   /translation="MDRLLNFLRPKRELFVGDFAIGVDRRPSVDMFQLVCRLALRYMRT
FT                   GKIECNVDSLQQFVVELLKTDCAAKWEWFMKRRSAGDYAIPLALAALPIAPLLSYTTKV
FT                   RTVSVKAFGNELTFPFRTLRPSLPRKGLLLRLAAGFALAPVCLLAVYATLPREKLSVFR
FT                   LRTEARTHMEDEREATECLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   VAQVARAKVGYLKNSPENRLIYQRVIIEIMDKDCVRYIDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVK"
FT   CDS             2649. .3815
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMT3"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q8JMT3"
FT                   /product="coat protein CP"
FT                   /protein_id="AAM49804.1"
FT                   /translation="MEIVRRNNNSAIAINKKQLATMAATAAAGALSNYVKNNGAMVVQG
FT                   AVNMGKKAYGAVRNRKNKGNSQAMVHVGGMGGAMMAPVAVSRQLVGSKPKFAGRTAGSV
FT                   TVTHREYLTQVNNSSAFTTNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYVFNSVVLH
FT                   YVPLCGTNEVGRVAMYWDKDSEDPEPADRVELANFGILKETAPWAEAILRVPTDKMKRY
FT                   CDDSTVVDRKLIDLGQLGISTYGGTGTNPVGDVFVSYSVTLYFPQPTNTLLSTRQLSLT
FT                   GALEASTGPGYINVTRTPTLLTITFRSTGTFLLSGVFRDTGVAVLGVTGGIGINSQTTL
FT                   DVVGVATSFLVNCTVSTLPATLTYGSAGITSVTANCTRATRANTVTLL"
FT   CDS             3847. .4422
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMT2"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q8JMT2"
FT                   /product="22 kDa movement protein"
FT                   /protein_id="AAM49805.1"
FT                   /translation="MDTEYEQVNKPWSELYKEATLGNKLTVNVGMEDVEVPLLPSNFLT
FT                   KVRVSLSGGYITVRRVRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTELLDLGKEI
FT                   RLTMQHLDFSVSARSDVPIVFGFEDLVSPFLEGRELFSVSLRWQFGLSAQCYSLPPAKW
FT                   KVMYQEEALKALKPSKKKASKTDSSRLE"
FT   CDS             3879. .4397
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMT1"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:Q8JMT1"
FT                   /product="19 kDa symptom severity modulator"
FT                   /protein_id="AAM49806.1"
FT                   /translation="MERAIQGSDAREQAYSERWDGGCGGTITPFKLPDESPSLIEWRLH
FT                   NSEESEDKDNPLGFKESWSFGKVVFKRYLRYDGTEASLHRALGSWERDTVNNAASRFLG
FT                   FGQIGCTYCIRFRGSCLTISGGSRTLQRLIEMAIRTKRTMLQLTPCEVEGNVSRGSPEG
FT                   TEAFKEESE"
XX
SQ   Sequence 4766 BP; 1237 A; 1003 C; 1315 G; 1211 T; 0 other;

 AY100482  Length: 4766  April 19, 2005 08:53  Type: N  Check: 1953  ..

       1  agaaattcct cagatttctc cctgttgacc aggagttatc ggtgagttgc
      51  gctttgtgct ttgcgtaagg gatttctctc gtacaggtac gatctcggac
     101  cagctacggg tttgaagggt gagcctattc ttcggaaggg taaattgtaa
     151  ctttcaccaa taagcaatgg atagattact gaactttctg agacctaaga
     201  gagaactttt cgtaggtgat tttgcgatcg gggttgacag gaggccatcg
     251  gtggacatgt tccagttggt gtgcaggttg gctctcagat atatgaggac
     301  agggaaaatc gagtgcaatg tggacagtct tcaacagttc gttgttgagt
     351  tgttaaagac tgattgcgca gccaaatggg aatggttcat gaaacggcgt
     401  tctgccggtg attatgctat cccccttgca ctggctgcac tacccattgc
     451  cccgctgttg agttatacca caaaggttag aacggtgagt gtaaaggcgt
     501  tcgggaatga attgactttc ccattcagga cccttcgccc aagcttaccc
     551  cgtaagggtt tgctccttcg gctggcggcc ggctttgcgt tagcacctgt
     601  atgcttgctt gctgtgtacg ctaccctgcc acgggaaaaa ctgtctgtat
     651  ttaggctgag aactgaggcc cgcacacata tggaggatga gagggaagca
     701  acggaatgtt tggtggtaga gccagctcga gagctcaagg gaaaggacgg
     751  ggaggatctc ctcactggta gtagaatgac aaaggtaatt gcgtctacag
     801  ggcgccctcg caggagacct tatgcagcga aagttgctca ggttgcaaga
     851  gctaaggtgg gttaccttaa gaatagtcct gagaatagat taatctacca
     901  gagagtcatc attgagatca tggacaagga ttgcgtcagg tatattgaca
     951  gggatgtcat attgcctttg gctattggat gttgttttgt ctacccggac
    1001  ggagtggaag agtcggcggc actctggggc tcgagcgagt ccctgggtgt
    1051  gaaataggga ggcctagtgc gtctacctgg ggttgtgaca cagaccaatc
    1101  gagatatccc atctggtgtg ttacttcccc aggaagtgct agaggttcgt
    1151  acaggacctc ccaatgctaa ggaccgtaat atatttatgg ttgctggttg
    1201  cccatcacag gcacggttct tagtgcataa tcattgcctg aaaaacctta
    1251  agaggggtct tgtggaaaga gttttctgtg ttgagaaaaa cggaattctc
    1301  actcgcactc cacaacctgc caaaggagcc tttagtcgtc tttccccgtt
    1351  caggaaagcg gtttgtgaga aggtcggagt tgcccaccgt tttgggtatg
    1401  atgggtttct atcatactac aacggtgcga agctgcgtac ttacacgcga
    1451  gccgtggaga gtctgcatat ctcccccgtc tgtgagaggg atagtcattt
    1501  gactaccttc gttaaggcgg agaagatatc gacgtctaag ggtgacccag
    1551  cgcctagggt gatacagcct cgtaacccta ggtacaatgt ggaacttgga
    1601  agatatctgc ggcatatgga gtccaaactg atgaaagctg tagatggcgt
    1651  atttggtgaa acgacatgca ttaagggtta caccgctgat gaggtggggc
    1701  agatctttag ggacaagtgg gacaaatttg atcgtccagt cgctattggt
    1751  cttgatgcct cacggtttga tcaacactgt tcggttgaag cgttgcaatt
    1801  tgagcatagc ttctacaggg ccatgtaccc tggcaacaag ctcttgagca
    1851  agttgctcga atggcaactc cacaataaag ggaaaggata tgtgcctgat
    1901  ggcactatta cctatcgtaa ggagggttgt cgtatgagtg gggatataaa
    1951  cacatcactt ggtaattacc tgttaatgtg tgccatgatt tatggttata
    2001  tgcgtcattt ggggatcaat gagtttagtc tggcgaactg tggggatgat
    2051  tgtgttctca ttgtagaacg caagcatctt aaacggatac aaggcacact
    2101  acccgagtat ttcctaaatc tgggttatac tatgaaggtg gaaccccctg
    2151  tatttcaatt ggaggaggtt gaattctgcc aggcacaccc agtacagttt
    2201  gaaggtggtt ggaagatggt tcggaatgtc cgtaccgcta tgagcaagga
    2251  tgtacactgt gttaacaata ttaaagatct ggctacacgc aaggcgtgga
    2301  gtaatgcaca acaccatggt ggcatagcac ttagtgctgg catacctgtg
    2351  gttgagaagt tttactcccg gtttgctttg tatgagatgc caaagagaca
    2401  ccaaagaatt gacacagtca caaacgtgca caagtggcgt ggatcgggtg
    2451  gaaagtatag tgtgacccct gagtcaaggg caagcttttg gcaagccttt
    2501  ggtctgacgg gggatgagca gcttgcttta gaggaccgtc tggatagatg
    2551  ggagatggac ctatttggag aggagggtgt tgacgctcat gagcccagca
    2601  tccttgactc cgccgtggcc tgaccaagtg aacacaagcg acatagcaat
    2651  ggaaatcgtt aggagaaaca ataatagtgc aatcgcaatc aacaagaaac
    2701  aactggccac tatggcggct actgccgccg ctggggctct gagcaattat
    2751  gtgaagaaca atggagcaat ggtcgtacaa ggtgcggtga atatgggcaa
    2801  gaaggcttat ggagcagtaa ggaatcgtaa gaataagggt aattcacagg
    2851  caatggtgca cgtaggtggt atgggcgggg ctatgatggc ccctgtggca
    2901  gtatcccggc aacttgtggg cagtaagcca aagttcgcag gtaggactgc
    2951  tggatcagtc acagtcaccc accgtgagta cttaacccag gtgaacaact
    3001  cctctgcttt tacaaccaat ggagggattg tcgggaattt gttacaactc
    3051  aacccgctta atggcacact gttttcgtgg ttaccggcta tcgcgtcgaa
    3101  cttcgatcag tacgtcttta acagcgttgt gttacattat gtccccctct
    3151  gtggcacaaa tgaagtaggg cgtgttgcaa tgtactggga taaggactct
    3201  gaggatcctg agcctgcgga tagagtggaa ttagctaatt tcggtatact
    3251  taaagagacg gccccatggg ccgaagctat tttgagggtc ccaactgata
    3301  agatgaaacg atactgcgat gacagtacag tggttgacag gaagcttatc
    3351  gacctcggac agctcggaat atctacatat ggaggaaccg gaactaatcc
    3401  tgtgggggat gtgtttgtgt cgtatagcgt tacgctttac ttcccacaac
    3451  ccacgaatac cctactcagc acgcgacagc ttagccttac tggcgcccta
    3501  gaagcatcta ctgggcctgg atatattaac gtaacacgta caccaacact
    3551  cttgactata acattcaggt ctaccggaac tttcctgctt tcgggagttt
    3601  tccgggacac tggtgttgct gttcttggtg tgacgggggg cataggaatt
    3651  aatagtcaaa ccacacttga tgttgttggc gtagccacat catttcttgt
    3701  gaactgtaca gtgtccacac tacccgctac actcacatat ggatctgctg
    3751  ggataacatc tgtcactgcg aattgcacac gggccacaag ggccaacacc
    3801  gtaacattgc tatagtcgcc tcggggcctc ttgaacagac cagttcatgg
    3851  atactgaata cgaacaagtc aataaaccat ggagcgagct atacaaggaa
    3901  gcgacgctag ggaacaagct tacagtgaac gttgggatgg aggatgtgga
    3951  ggtaccatta ctcccttcaa acttcctgac gaaagtccga gtctcattga
    4001  gtggaggcta cataacagtg aggagagtga ggataaagat aatccccttg
    4051  gtttcaagga aagctggagt ttcgggaaag ttgtatttaa gagatatctc
    4101  agatacgacg ggacggaagc ttcattgcac agagctcttg gatcttggga
    4151  aagagatacg gttaacaatg cagcatctag atttctcggt ttcggccaga
    4201  tcggatgtac ctattgtatt cggtttcgag gatcttgtct caccatttct
    4251  ggagggtcgc gaactcttca gcgtctcatt gagatggcaa ttcggactaa
    4301  gcgcacaatg ctacagctta ccccctgcga agtggaaggt aatgtatcaa
    4351  gaggaagccc tgaaggcact gaagccttca aagaagaaag cgagtaagac
    4401  agactcttca cgcttggagt gaagtttggt ggcaactata caccttagac
    4451  tactggttac tactgtcagg ttggaaccca cattaattga gctaggtcgg
    4501  gccccgtcgt aggattggtc acctacggaa tggggatatg gaaaggatct
    4551  cgtaccctgt gagtcaaacg aaagttgtgc ttgggatatg gatctatgcc
    4601  tagtaggtta tgtggtgtgt ctctgacttt aattggatgc cagttttcaa
    4651  caggagtgga agtaactgaa caacactttg agcacggttg atctcaccct
    4701  ccgggggggc tatagagatc gctggaaaca ctaccggaca accggaacat
    4751  tgcagaaatg cagccc