Sequence of DPV Cucumber Bulgarian virus

Cucumber Bulgarian virus RNA polymerase pre-readthrough protein, RNA polymerase, coat protein, movement protein, and symptom severity modulator genes, complete cds.

ACC No: AY163842

Dated: 2005-04-16 | Length: 4576 | CRC: -1767691918

                !!NA_SEQUENCE 1.0
ID   AY163842   standard; genomic RNA; VRL; 4576 BP.
XX
AC   AY163842;
XX
SV   AY163842.1
XX
DT   10-FEB-2003 (Rel. 74, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Cucumber Bulgarian virus RNA polymerase pre-readthrough protein, RNA
DE   polymerase, coat protein, movement protein, and symptom severity modulator
DE   genes, complete cds.
XX
KW   .
XX
OS   Cucumber Bulgarian virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4576
RA   Russo M., Kostova D., Lisa V., Marzache C., Rubino L.;
RT   "Molecular characterization of a tombusvirus isolated from cucumber in
RT   Bulgaria";
RL   Unpublished.
XX
RN   [2]
RP   1-4576
RA   Russo M.;
RT   ;
RL   Submitted (15-OCT-2002) to the EMBL/GenBank/DDBJ databases.
RL   Istituto di Virologia Vegetale Sezione di Bari, Consiglio Nazionale Delle
RL   Ricerche, Via Amendola 165/A, Bari, BA 70126, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4576
FT                   /db_xref="taxon:220618"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cucumber Bulgarian virus"
FT   CDS             135. .2507
FT                   /codon_start=1
FT                   /db_xref="GOA:Q80R16"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q80R16"
FT                   /note="89 kDa"
FT                   /transl_except=(pos:939. .941,aa:Glx)
FT                   /product="RNA polymerase"
FT                   /protein_id="AAO33940.1"
FT                   /translation="MDTIRRLFGKNQQIFVGQHAIGVETGPKIDMFSLICKVVLRYMQT
FT                   GKIEHKVDGLSGFVVELLKTDAAAKWDWFMRRARRTDYVGAVSCLSAIAILPLWCAKRW
FT                   YSRLAVGMLLTPVCVAAAYATLPREKLSTYRLRSEAREHMEDEKEATECLVVEEARQLK
FT                   GKDGEDIITGSRLTRVVAKTGRPRRRPYAAKIAQVARAKVGYLKNTPENRLIYQRVLIE
FT                   IMDKDCVRYCDRDGVLPLAIGCCFVYPEGTEEASQLWGSQESLGVKZGGLVRLPGVVTS
FT                   INRDIPSDVLLPQEVLEVRAGPPLSKNRNLYMVAGCPSQARFLVHNHCLRNLKRGLVER
FT                   VFCVEKEGRLVRTPQPKPGAFASLSPFRKAVCEKVGVSQRLGYDGFLSYYSGAKLRTYS
FT                   RAVESLHITPVCERDSHLTTFVKAEKISTSKGDPAPRVIQPRNPRYNVELGRFLRHLES
FT                   KLMKAVDAVFGETTCIKGYTADEVGAIFRDKWDRFDKPCAIGLDASRFDQHCSVEALRF
FT                   EHGFYRALYPGSKVLDRLLEWQLHNKGKGYVPDGTISYRKEGCRMSGDINTSLGNYLLM
FT                   CSMVFGFMRHCGINEYSLANCGDDCVLIIEKRCLKQVQAKLPGYFLNLGYTMKVEEPVF
FT                   QLEEIEFCQAHPVNFQGGWKMVRNVRTAMSKDSHCVNNINDEQTRRAWSNAQHVGGRAL
FT                   SAGIPVVDKFYSRFKLYDPPRKHQRIDTVTNVHKWRGSGGDYVITPESRASFWQAFKLT
FT                   GDEQIALEDRLDRWDMDLFGREGTDSHEPSILDSAAA"
FT   CDS             135. .941
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q80R15"
FT                   /note="30 kDa; required for readthrough of 89 kDa protein"
FT                   /product="RNA polymerase pre-readthrough protein"
FT                   /protein_id="AAO33939.1"
FT                   /translation="MDTIRRLFGKNQQIFVGQHAIGVETGPKIDMFSLICKVVLRYMQT
FT                   GKIEHKVDGLSGFVVELLKTDAAAKWDWFMRRARRTDYVGAVSCLSAIAILPLWCAKRW
FT                   YSRLAVGMLLTPVCVAAAYATLPREKLSTYRLRSEAREHMEDEKEATECLVVEEARQLK
FT                   GKDGEDIITGSRLTRVVAKTGRPRRRPYAAKIAQVARAKVGYLKNTPENRLIYQRVLIE
FT                   IMDKDCVRYCDRDGVLPLAIGCCFVYPEGTEEASQLWGSQESLGVK"
FT   CDS             2526. .3668
FT                   /codon_start=1
FT                   /db_xref="GOA:Q80R14"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q80R14"
FT                   /note="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAO33941.1"
FT                   /translation="MALVLRKAGNIVPYVGPAAKAGATAVYNNRKIIYDGLNWIYAKVS
FT                   KRVKKKNGIMSNVVGASPGSIVAPVATSRQLRASRPKFMRTRGGVNITHREYVTQVNGV
FT                   NGGTFQLNRTFGPGAYRVNPTNAAVFPWLLNIASNFDKYKFTRLSFHYVPMCATTEVGR
FT                   VGLFFDRDSEDSGPFDRSEVANMAHLAETPPWGEVVLQVPCDSIDRFISDSTVTDTKLI
FT                   DLGRFGYVVYGGSTNNAYGDVFVQYTVELREPQPSSNTMEEITGNAGNSVVTTPPSYFR
FT                   LASFDATLAAFTPTTAGTYLVTLILEGTAMTAGNISTSNPSALTITGQSVVVSATKVIY
FT                   VCQVIASTPGHNLNFNFTAASATFWNFFAVRTTRDIIISA"
FT   CDS             3709. .4260
FT                   /codon_start=1
FT                   /db_xref="GOA:Q80R13"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q80R13"
FT                   /note="21 kDa"
FT                   /product="movement protein"
FT                   /protein_id="AAO33942.1"
FT                   /translation="MDTEYEQVNKPWNELYKEITLGNKLLVNVGMEDMEVPLLPSNFLT
FT                   KARIGMSGGYITVRRIRIKIIPLVSRKAGVSGKLYLRDITDTTGKKLHCTELLDLGREI
FT                   RLTMRHLDFSVSTKSDVPIVFGFEELVSPFLEGRELFSVSLKWQFGLSSQSYSLPQTKW
FT                   KVMYQEDALKQIKTAHRKRT"
FT   CDS             3741. .4247
FT                   /codon_start=1
FT                   /db_xref="GOA:Q80R12"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q80R12"
FT                   /note="19 kDa"
FT                   /product="symptom severity modulator"
FT                   /protein_id="AAO33943.1"
FT                   /translation="MERIVQGDHTGKQAVGECWDGRYGSTITPFQLPDESPNRDEWRVH
FT                   HCETNPHKDYPLGFKESWGFGKVVFKRYYRHDWKETSLHRVIRSWSGDTVNYAASRFFG
FT                   VNQVGCTYSIRIRGISVTLSGGSGTLQRLIEMAIRIKLSELQLASDEMEGHVSGGCPEA
FT                   DQNCT"
XX
SQ   Sequence 4576 BP; 1178 A; 947 C; 1261 G; 1190 T; 0 other;

 AY163842  Length: 4576  April 19, 2005 08:52  Type: N  Check: 4211  ..

       1  agaaattctc cagcctgacc aggtggtgag ttgcggtgtt gtctaccgta
      51  gaggatttct ctcgtgcctt gttacgggtt tgaagggcga gcctatcttc
     101  ggagggtaaa ttgtaacttt cgccaaacag gactatggat actatcaggc
     151  ggcttttcgg gaagaaccag cagatctttg ttggacagca tgcgattggt
     201  gtagaaactg gacccaagat tgacatgttc tctctcatat gtaaagtggt
     251  cctcaggtat atgcagacag ggaaaataga gcacaaggtc gatggactga
     301  gtggattcgt ggttgagtta ctcaagactg atgccgctgc taagtgggat
     351  tggtttatga gaagggcgag gagaactgac tacgttggtg cggtcagttg
     401  tctttctgcc atagccatcc ttccactctg gtgcgccaag aggtggtact
     451  ctcggctggc ggtgggaatg ctgttaacac cagtttgtgt tgcagcagca
     501  tacgctaccc tacctaggga aaaactgtct acttatcgcc tgagaagtga
     551  ggccagggaa cacatggagg atgagaagga agctactgag tgcttggtgg
     601  ttgaggaagc tcgtcaactc aaaggaaagg atggtgagga tattatcact
     651  gggagtaggt taactagggt tgtggcaaaa accggacgcc ctagaaggag
     701  gccatatgcg gcgaagatag ctcaggttgc tcgtgctaaa gtgggttatc
     751  ttaagaacac tcctgagaat aggctcatct atcagagggt acttattgag
     801  ataatggata aagattgtgt gaggtattgt gaccgtgatg gtgtcctacc
     851  cctcgcaatc ggatgttgtt ttgtataccc tgaaggaaca gaggaggcga
     901  gtcagctctg gggctctcaa gagtccctcg gcgtgaaata gggaggccta
     951  gtgcgtctcc ctggggtggt gactagcatt aatcgtgata tcccatctga
    1001  tgtgttgctt ccccaggagg tgctagaggt tcgtgcagga cctcccctat
    1051  ctaagaatcg taatttatac atggttgcag gttgcccatc acaggcacga
    1101  ttcttagtcc ataatcactg cctgagaaac ctgaaacgtg gtcttgtgga
    1151  gagagtcttc tgtgtggaga aagaaggaag actcgttcgc actccacaac
    1201  ccaaacctgg ggcctttgct agtctttccc cgttcaggaa agctgtctgt
    1251  gagaaggtcg gagtttccca acgcttgggg tatgacggat ttctgtcata
    1301  ctacagtggg gcgaaattgc gcacttactc gcgggcggtg gagagtctgc
    1351  atatcactcc tgtctgtgag cgtgatagtc atttgactac ttttgtaaag
    1401  gcagagaaga tatcgactag taagggtgat cctgcaccta gggttattca
    1451  gcctcgcaac cctaggtaca atgttgaatt aggtcgtttt ctgcggcatt
    1501  tggagagtaa gctcatgaaa gcggttgacg cagtttttgg tgagaccaca
    1551  tgtatcaagg ggtacactgc agatgaggtc ggcgctatct tcagggacaa
    1601  atgggacagg tttgataagc catgtgccat tggcctagat gcgtcgaggt
    1651  ttgatcaaca ctgttccgtg gaagccttac ggtttgaaca tggcttctac
    1701  cgggcccttt acccgggtag taaggtcctg gaccgactat tggaatggca
    1751  actccataat aaggggaagg gatatgtgcc tgatggcacc atctcatatc
    1801  gaaaggaggg ttgcagaatg agtggggata taaacacctc tctgggaaat
    1851  tatttgttaa tgtgctctat ggtctttggt ttcatgcgac actgtggcat
    1901  caatgaatat agtctggcaa actgtggaga tgactgtgtc ctcattattg
    1951  agaagcggtg tcttaaacag gtgcaggcga aactacctgg gtatttcctt
    2001  aacttggggt ataccatgaa ggtagaggag cctgtatttc aattggaaga
    2051  gattgaattc tgtcaggcgc atccagtcaa ctttcagggc ggttggaaga
    2101  tggtccgaaa tgtaaggacg gcaatgtcta aggattccca ttgtgttaat
    2151  aacattaacg atgagcaaac taggcgcgcg tggagtaatg cacaacatgt
    2201  gggcggtaga gctttgtctg ctggcatacc agtggtggac aagttctact
    2251  ctaggttcaa actctatgat ccgcctagga agcatcagcg aatagacacc
    2301  gtcacaaatg tccataaatg gaggggatct ggtggtgatt atgtaatcac
    2351  accagaaagc agggccagct tctggcaagc ttttaagctt accggggatg
    2401  aacagatagc ccttgaggac agattggacc gatgggacat ggatctcttt
    2451  gggagggagg gtaccgactc acatgagccg agtatcctcg actccgccgc
    2501  agcttgacca aacaacattg aaaacatggc tttagtgctt aggaaagcag
    2551  ggaatattgt gccttatgtt ggccccgcgg ccaaagcagg cgcaacagca
    2601  gtctataata acaggaagat tatatatgat ggcctgaatt ggatttacgc
    2651  caaggtttcc aagagggtga agaagaagaa tggaattatg tccaatgtag
    2701  taggagcatc acctggatct attgtggccc ctgtggccac ctccaggcag
    2751  ttgagggcta gtagacctaa gtttatgcga acacgtggag gtgtcaacat
    2801  cacccatcgt gagtatgtca cacaagttaa tggtgtgaat ggtggtactt
    2851  ttcagttgaa tcggactttt gggccaggtg cctatcgcgt caaccccacg
    2901  aacgcggcag tgtttccctg gttgcttaat atagcatcca atttcgacaa
    2951  gtataagttt accagattat cattccacta tgttcccatg tgtgcgacca
    3001  cggaggttgg tagagttggg ctattctttg atagggactc ggaggatagt
    3051  ggcccatttg acagatctga ggtagcaaat atggcacatc ttgctgaaac
    3101  acctccttgg ggggaggttg ttttacaggt cccatgtgat agcatcgacc
    3151  ggtttattag cgatagtacc gtaactgaca ccaaacttat tgatttgggt
    3201  cggtttggtt acgtggttta tggggggagt acgaacaatg catatggtga
    3251  tgtctttgtg caatacaccg tagagctccg agaaccccaa ccatcctcaa
    3301  ataccatgga ggagataaca ggcaatgctg gtaattcggt tgtcactaca
    3351  ccgcccagct attttagatt ggcgtccttc gatgcaacgt tggcggcgtt
    3401  tacacctact acagctggca cctatcttgt cactctcatc ttggaaggaa
    3451  ctgcaatgac ggcggggaat atctcgacat ctaatcctag tgcgttgaca
    3501  atcaccggac agagtgtggt ggtttccgcc acaaaggtta tttatgtttg
    3551  ccaagttatt gcatccacac caggccataa tcttaacttt aatttcactg
    3601  ctgcgtcggc tacattctgg aatttctttg ctgtgcgcac cacacgcgat
    3651  attattatca gcgcttagtc atgtcttact ttaggggcct cttgaaatag
    3701  accatttcat ggatactgag tacgaacaag ttaacaaacc atggaacgaa
    3751  ttgtacaagg agatcacact gggaaacaag ctgttggtga atgttgggat
    3801  ggaagatatg gaagtaccat tactcccttc caacttcctg acgaaagccc
    3851  gaatagggat gagtggaggg tacatcactg tgagacgaat ccgcataaag
    3901  attatcccct tggtttcaag gaaagctggg gtttcgggaa agttgtattt
    3951  aagagatatt acagacacga ctggaaagaa acttcactgc accgagttat
    4001  tagatcttgg tcgggagata cggttaacta tgcggcatct cgatttttcg
    4051  gtgtcaacca agtcggatgt acctatagta ttcggattcg aggaattagt
    4101  gtcacccttt ctggagggtc gggaactctt cagcgtctca ttgaaatggc
    4151  aattcggatt aagctctcag agttacagct tgcctcagac gaaatggaag
    4201  gtcatgtatc aggaggatgc cctgaagcag atcaaaactg cacatagaaa
    4251  gcgaacttga cagactctca agcaaggtat gaagttaagg agtggaaccc
    4301  ggattaattg taacctgtaa ttattctcgt ggtggtacga cctcaggctg
    4351  gtcacctggg actgcgtagg acgggaggtg tcctcttatg ggcgctagtt
    4401  attggtgaaa cggggagacg ggtggggacg acacggttgt atatagtcca
    4451  caacacccac ctgttgcaaa ctctggaaga tagtatctcg cacggttaca
    4501  ccccatcctt cgggagggct ttaggggtgt gctggaagca ccaccggaca
    4551  gccggaacat tgccgaaagg cagccc