Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate M2 major coat protein gene, complete cds.

ACC No: AY190048

Dated: 2006-06-22 | Length: 672 | CRC: -1510726829

                
ID   AY190048; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AY190048;
XX
DT   03-JAN-2003 (Rel. 74, Created)
DT   22-JUN-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate M2 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barzegar A., Hashemi Sohi H., Rahimian H.;
RT   "Characterization of Citrus tristeza virus isolates in northern Iran";
RL   J. Gen. Plant Pathol. 72(1):46-51(2006).
XX
RN   [2]
RP   1-672
RA   Barzegar A., Rahimian H., Hashemi Sohi H.;
RT   ;
RL   Submitted (04-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   Plant Molecular Biology, National Research Center for Genetic Engineering
RL   and Biotechnology, P.O. Box: 14155 6343, Tehran, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="M2"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="p25"
FT                   /db_xref="GOA:Q8B3R9"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B3R9"
FT                   /protein_id="AAO12732.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDFVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 125 C; 173 G; 180 T; 0 other;

ay190048 Length: 672  22-JUN-2006  Type: N  Check: 1169  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat tttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgcacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga