Sequence of DPV Bamboo mosaic virus satellite RNA

Satellite RNA of bamboo mosaic potexvirus strain DLIII-7 P20 protein gene, complete cds.

ACC No: AY205184

Dated: 2004-05-06 | Length: 837 | CRC: -561134490

                !!NA_SEQUENCE 1.0
ID   AY205184   standard; genomic RNA; VRL; 837 BP.
XX
AC   AY205184;
XX
SV   AY205184.1
XX
DT   06-MAY-2004 (Rel. 79, Created)
DT   06-MAY-2004 (Rel. 79, Last updated, Version 1)
XX
DE   Satellite RNA of bamboo mosaic potexvirus strain DLIII-7 P20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Satellite RNA of bamboo mosaic potexvirus
OC   Viruses; Satellites; Satellite Nucleic Acids;
OC   unclassified Satellite Nucleic Acids.
XX
RN   [1]
RP   1-837
RA   Yeh W.B., Lin N.S.;
RT   "Phylogenetic analysis in short- and long-term dynamics in satellite RNA of
RT   bamboo mosaic virus";
RL   Unpublished.
XX
RN   [2]
RP   1-837
RA   Yeh W.B., Lin N.S.;
RT   ;
RL   Submitted (19-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Botany, Academia Sinica, R124, Nankang, Taipei 115, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .837
FT                   /db_xref="taxon:222418"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Satellite RNA of bamboo mosaic potexvirus"
FT                   /strain="DLIII-7"
FT                   /isolation_source="symptomatic bamboo leaves"
FT                   /clone="7"
FT   CDS             161. .712
FT                   /codon_start=1
FT                   /product="P20 protein"
FT                   /protein_id="AAP31355.1"
FT                   /translation="MVGRRNRRQRSRVSQMTDIMYGSLTLGSTTTWTRKNFPGLANMGD
FT                   RPFQVISAKIVVSSASPMLYQARLYSPHDDDNVGSTGLQMSGTTPRTHRMRALPGQNTW
FT                   FSGNTSSTQVIVAIDGLKTRTTDVTPQNAVAVQISYRVAPSELQSATGNSEMPVTTPFD
FT                   LPEGYEYLADAWLPDRASTS"
XX
SQ   Sequence 837 BP; 213 A; 234 C; 210 G; 180 T; 0 other;

  AY205184  Length: 837  May 17, 2004 16:47  Type: N  Check: 5926  ..

       1  gaaaactcac cgcaacgaaa cgaaaataat cgttcagaaa tacttgacca
      51  tgaggggtcc cctatagtct gctttggcgg tgcggcagcc cccgtgcgat
     101  aggctaactg cggtattccc cgcactccgt cgagcggtta atacgacgct
     151  taccaagacg atggtaggga ggagaaaccg tcgccagaga tcgcgtgttt
     201  cccagatgac cgacatcatg tatggctcac taacactggg cagtaccaca
     251  acatggacca ggaagaattt tcctgggttg gccaatatgg gagatagacc
     301  tttccaggtc atctctgcaa aaattgttgt ctcgtctgcc tcccccatgc
     351  tttaccaagc caggctctac tcaccacacg atgacgacaa tgtggggtct
     401  accgggctac aaatgtccgg aaccactcca cgtactcacc gaatgagagc
     451  tctgccaggt caaaatacct ggtttagtgg caacacgagc tccactcagg
     501  tgattgtcgc tattgatggc ctgaagacga ggacaacgga tgtcacgccc
     551  cagaacgcgg tggccgttca gatttcgtat cgggtggcgc cgagcgaact
     601  ccagagcgca actggtaact ctgaaatgcc cgtaaccacg ccttttgacc
     651  tcccagaggg gtatgaatac cttgctgacg cgtggctccc tgaccgtgca
     701  tcaaccagtt gatccatgag cacaaccggc ttgtcaatga gccgccaggt
     751  ttagcctggt tccacattga cccaccacct atactatgag acctaatcag
     801  tagtggtggt cgtcccgaat aaagacgtta aaagatg