Sequence of DPV Bamboo mosaic virus satellite RNA

Satellite RNA of bamboo mosaic potexvirus strain DLIV-3 P20 protein gene, complete cds.

ACC No: AY205189

Dated: 2004-05-06 | Length: 835 | CRC: -1586629353

                !!NA_SEQUENCE 1.0
ID   AY205189   standard; genomic RNA; VRL; 835 BP.
XX
AC   AY205189;
XX
SV   AY205189.1
XX
DT   06-MAY-2004 (Rel. 79, Created)
DT   06-MAY-2004 (Rel. 79, Last updated, Version 1)
XX
DE   Satellite RNA of bamboo mosaic potexvirus strain DLIV-3 P20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Satellite RNA of bamboo mosaic potexvirus
OC   Viruses; Satellites; Satellite Nucleic Acids;
OC   unclassified Satellite Nucleic Acids.
XX
RN   [1]
RP   1-835
RA   Yeh W.B., Lin N.S.;
RT   "Phylogenetic analysis in short- and long-term dynamics in satellite RNA of
RT   bamboo mosaic virus";
RL   Unpublished.
XX
RN   [2]
RP   1-835
RA   Yeh W.B., Lin N.S.;
RT   ;
RL   Submitted (19-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Botany, Academia Sinica, R124, Nankang, Taipei 115, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .835
FT                   /db_xref="taxon:222418"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Satellite RNA of bamboo mosaic potexvirus"
FT                   /strain="DLIV-3"
FT                   /isolation_source="symptomatic bamboo leaves"
FT                   /clone="3"
FT   CDS             159. .710
FT                   /codon_start=1
FT                   /product="P20 protein"
FT                   /protein_id="AAP31360.1"
FT                   /translation="MVGRRNRRQRSRVSQMTDIMYGSLTLGSTTTWTRKNFPGLANMGD
FT                   RPFQVISAKIVVSSASPMLYQARLYSPHDDDNVGSTGLQMSGTTPRTHRMRALPGQNTW
FT                   FSGNTSSTQVIVAIDGLKTKTSDVTPQNAVAVQISYRVAPSELQSATGNAEMPVTTPFD
FT                   LPEGYEYLADAWLPDRASAS"
XX
SQ   Sequence 835 BP; 213 A; 236 C; 210 G; 176 T; 0 other;

  AY205189  Length: 835  May 17, 2004 16:47  Type: N  Check: 6266  ..

       1  gaaaactcac cgcaacgaaa cgaaaacaat cgttcagaaa tacttgacca
      51  cgagggttcc ctatagtccg cgttggcggt gctgcaaccc cgtgcgatag
     101  gctaactgcg gtattccccg cactccgtcg agcggtaaat acgacgctta
     151  ccaagacgat ggtagggagg agaaaccgtc gccagagatc gcgtgtttcc
     201  cagatgaccg acatcatgta tggctcacta acactgggca gtaccacaac
     251  atggaccagg aagaattttc ctgggttggc caatatggga gatagaccct
     301  ttcaggtcat ctctgcaaaa attgttgtct cgtctgcctc ccccatgctt
     351  taccaagcca ggctttactc accacacgat gacgacaatg tggggtctac
     401  cgggctacaa atgtccggaa ccactccacg tactcaccga atgagagctc
     451  tgccaggtca aaatacctgg tttagtggca acacgagctc cactcaggtg
     501  attgttgcca ttgatggcct gaagacgaag acatcggatg tcacgcccca
     551  gaacgcggtg gccgttcaga tttcgtatcg ggtggcgccg agcgaactcc
     601  agagcgcaac tggtaacgcc gaaatgcccg taaccacgcc ttttgacctc
     651  ccagaggggt atgaatacct cgctgacgcg tggctccctg accgtgcatc
     701  agccagttga tccatgagca caaccggctt gtcaatgagc cgccaggttt
     751  ggcctggttc cacattgacc caccacctat actatgagac ctaatcagta
     801  gtggtggtcg tcccgaataa agacgttaaa agatg