Sequence of DPV Bamboo mosaic virus satellite RNA

Satellite RNA of bamboo mosaic potexvirus strain DL15 P20 protein gene, complete cds.

ACC No: AY205213

Dated: 2004-05-06 | Length: 834 | CRC: 2094034654

                !!NA_SEQUENCE 1.0
ID   AY205213   standard; genomic RNA; VRL; 834 BP.
XX
AC   AY205213;
XX
SV   AY205213.1
XX
DT   06-MAY-2004 (Rel. 79, Created)
DT   06-MAY-2004 (Rel. 79, Last updated, Version 1)
XX
DE   Satellite RNA of bamboo mosaic potexvirus strain DL15 P20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Satellite RNA of bamboo mosaic potexvirus
OC   Viruses; Satellites; Satellite Nucleic Acids;
OC   unclassified Satellite Nucleic Acids.
XX
RN   [1]
RP   1-834
RA   Yeh W.B., Lin N.S.;
RT   "Phylogenetic analysis in short- and long-term dynamics in satellite RNA of
RT   bamboo mosaic virus";
RL   Unpublished.
XX
RN   [2]
RP   1-834
RA   Yeh W.B., Lin N.S.;
RT   ;
RL   Submitted (19-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Botany, Academia Sinica, R124, Nankang, Taipei 115, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .834
FT                   /db_xref="taxon:222418"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Satellite RNA of bamboo mosaic potexvirus"
FT                   /strain="DL15"
FT                   /isolation_source="symptomatic bamboo leaves"
FT   CDS             158. .709
FT                   /codon_start=1
FT                   /product="P20 protein"
FT                   /protein_id="AAP31382.1"
FT                   /translation="MVGRRNRRQRSRVSQMTDIMYGSLTLGSTTTWTRKNFPGLVNMGD
FT                   RPFQVISVRIVVSSASPMLYQARLYSPHDDDNVGSTGLQMSGTTPRTHRMRALPGQNTW
FT                   FSGNTSSTQVIVAIDGLKTKTSDVTPQNAVAVQISYRVAPSELQSATGNAEMPVTTPFD
FT                   LPEGYEYLADAWLPDRASTS"
XX
SQ   Sequence 834 BP; 212 A; 232 C; 209 G; 181 T; 0 other;

  AY205213  Length: 834  May 17, 2004 16:46  Type: N  Check: 8957  ..

       1  gaaaactcac cgcaacgaaa cgaaacaaat cgttcagaaa tacttgacca
      51  cgagggcccc cctatagtcc agttttggtg cggcggcccc gtgcgatagg
     101  ctaactgcgg tattccccgc actccgtcga gcggttaata cgacgcttac
     151  caagacgatg gtagggagga gaaaccgtcg ccagagatcg cgtgtttccc
     201  agatgaccga catcatgtat ggctcactaa cactgggcag taccacaaca
     251  tggaccagga agaattttcc tgggttggtc aatatgggag atagaccctt
     301  ccaggtcatc tctgttagaa ttgttgtctc gtctgcctcc cccatgcttt
     351  atcaagccag gctctactca ccacacgatg atgacaatgt ggggtctact
     401  gggctacaaa tgtctggaac cacaccacgt actcaccgaa tgagagctct
     451  gccaggtcaa aatacctggt ttagtggcaa cacgagctcc actcaggtga
     501  ttgtcgctat tgatggcctg aagacgaaga catcggatgt cacgccccag
     551  aacgcggtgg ccgttcagat ttcgtatcgg gtggcgccga gcgaactcca
     601  gagcgcaact ggtaacgccg aaatgcctgt aaccacgcct tttgacctcc
     651  cagaggggta tgaatacctt gccgacgcgt ggctccctga ccgtgcatca
     701  accagttgat ccatgagcac aaccggcttg tcaatgagcc gccaggttta
     751  gcctggttcc acattgaccc accacctata ctatgagacc taatcagtag
     801  tggtggtcgt cccgaataaa gacgttaaaa gatg