Sequence of DPV Bamboo mosaic virus satellite RNA

Satellite RNA of bamboo mosaic potexvirus strain BO20 P20 protein gene, complete cds.

ACC No: AY205220

Dated: 2004-05-06 | Length: 835 | CRC: -1865404943

                !!NA_SEQUENCE 1.0
ID   AY205220   standard; genomic RNA; VRL; 835 BP.
XX
AC   AY205220;
XX
SV   AY205220.1
XX
DT   06-MAY-2004 (Rel. 79, Created)
DT   06-MAY-2004 (Rel. 79, Last updated, Version 1)
XX
DE   Satellite RNA of bamboo mosaic potexvirus strain BO20 P20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Satellite RNA of bamboo mosaic potexvirus
OC   Viruses; Satellites; Satellite Nucleic Acids;
OC   unclassified Satellite Nucleic Acids.
XX
RN   [1]
RP   1-835
RA   Yeh W.B., Lin N.S.;
RT   "Phylogenetic analysis in short- and long-term dynamics in satellite RNA of
RT   bamboo mosaic virus";
RL   Unpublished.
XX
RN   [2]
RP   1-835
RA   Yeh W.B., Lin N.S.;
RT   ;
RL   Submitted (19-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Botany, Academia Sinica, R124, Nankang, Taipei 115, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .835
FT                   /db_xref="taxon:222418"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Satellite RNA of bamboo mosaic potexvirus"
FT                   /strain="BO20"
FT                   /isolation_source="symptomatic bamboo leaves"
FT   CDS             159. .710
FT                   /codon_start=1
FT                   /product="P20 protein"
FT                   /protein_id="AAP31389.1"
FT                   /translation="MVRRRNRRQRSRVSQMTDIMYGSLTLGSTTTWTRKNFPGLANMGD
FT                   RPFQVISVKIVVSSASPMLYQARLYSPHDDDNVGSTGLQMSGTTPRTHHMRALPGQNTW
FT                   FSGNTSSTQVIVAIDGLKTKTTDATPQNAVAVQVFYRVAPSELQSATGNAEMPTTTPFD
FT                   LPEGYEYLADAWLPDRASTS"
XX
SQ   Sequence 835 BP; 212 A; 240 C; 208 G; 175 T; 0 other;

  AY205220  Length: 835  May 17, 2004 16:46  Type: N  Check: 6118  ..

       1  gaaaactcac cgcaacgaaa cgaaacaaat cgttcagaaa cactagacca
      51  tgagggttcc cctatagtcc cgctgagggt gcggtggccc cgtgcgatag
     101  gctaactgtg gtgttccccg cactccgtcg agcggttaat acgacgctta
     151  ccaagacgat ggttcggagg agaaaccgtc gccagagatc gcgtgtctcc
     201  caaatgaccg acatcatgta tggctcacta acactgggca gtaccacaac
     251  atggaccagg aagaatttcc ctgggttggc caatatggga gatcgacctt
     301  tccaggtcat ctctgtaaaa attgttgtct cgtctgcctc ccccatgctt
     351  taccaagcca ggctttactc accacacgat gatgacaatg tggggtccac
     401  cgggcttcaa atgtctggaa ccactccacg cactcaccat atgagagctc
     451  tgccaggtca aaacacctgg tttagtggca acacgagctc tactcaggtg
     501  attgtcgcca ttgatggcct gaagacgaag acaacggatg ccacgcccca
     551  gaacgcggtg gccgttcagg tgttctatcg agtggcgccg agcgaactcc
     601  agagcgcaac tggtaatgct gaaatgccta caaccacgcc ttttgacctc
     651  ccagaggggt atgaatacct cgctgacgcg tggctccctg atcgtgcgtc
     701  aaccagttga tccacgagca caaccggctt gtcaatgagc cgccaggttt
     751  agcctggttc cacattgacc caccacccat actatgagac ctaaccagta
     801  gtggtggtcg tcccgaataa agacgttaaa agatg