Sequence of DPV Bamboo mosaic virus satellite RNA

Satellite RNA of bamboo mosaic potexvirus strain BSF4 P20 protein gene, complete cds.

ACC No: AY205227

Dated: 2004-05-06 | Length: 836 | CRC: 514228652

                !!NA_SEQUENCE 1.0
ID   AY205227   standard; genomic RNA; VRL; 836 BP.
XX
AC   AY205227;
XX
SV   AY205227.1
XX
DT   06-MAY-2004 (Rel. 79, Created)
DT   06-MAY-2004 (Rel. 79, Last updated, Version 1)
XX
DE   Satellite RNA of bamboo mosaic potexvirus strain BSF4 P20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Satellite RNA of bamboo mosaic potexvirus
OC   Viruses; Satellites; Satellite Nucleic Acids;
OC   unclassified Satellite Nucleic Acids.
XX
RN   [1]
RP   1-836
RA   Yeh W.B., Lin N.S.;
RT   "Phylogenetic analysis in short- and long-term dynamics in satellite RNA of
RT   bamboo mosaic virus";
RL   Unpublished.
XX
RN   [2]
RP   1-836
RA   Yeh W.B., Lin N.S.;
RT   ;
RL   Submitted (19-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Botany, Academia Sinica, R124, Nankang, Taipei 115, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .836
FT                   /db_xref="taxon:222418"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Satellite RNA of bamboo mosaic potexvirus"
FT                   /strain="BSF4"
FT                   /isolation_source="symptomatic bamboo leaves"
FT   CDS             160. .711
FT                   /codon_start=1
FT                   /product="P20 protein"
FT                   /protein_id="AAP31396.1"
FT                   /translation="MVRRRNRRQRSRVSQMTDIMYGSLTLGSTTTWTRKNFPGLANMGD
FT                   RPFQVISVKIVVSSASPMLYQARLYSPHDDDNVGSTGLQMSGTTPHTHHMRALPGQNTW
FT                   FSGNTSSTQVIVAIDGLKTKTTDATPQNAVAVQVFYRVAPSELQSATGNAEMPTTTPFD
FT                   LPEGYEYLADAWLPDRAPTS"
XX
SQ   Sequence 836 BP; 214 A; 245 C; 206 G; 171 T; 0 other;

  AY205227  Length: 836  May 17, 2004 16:46  Type: N  Check: 7813  ..

       1  gaaaactcac cgcaacgaaa cgaaacaaat cgttcagaaa cactagacca
      51  cgagggcccc cctatagtcc cgctgagggt gtggcaggcc ccgtgcgata
     101  ggctaactgt ggtgttcccc gcactccgtc gagcggttaa tacgacgctt
     151  accaagacga tggttcggag gagaaatcgt cgccagagat cgcgtgtctc
     201  ccaaatgacc gacatcatgt atggctcact aacactgggc agtaccacaa
     251  catggaccag gaagaatttc cctgggttgg ccaatatggg agatcgacct
     301  ttccaggtca tctctgttaa aattgttgtc tcgtctgcct cccccatgct
     351  ttaccaagcc aggctttact caccacacga tgatgacaat gtggggtcca
     401  ccgggcttca aatgtctgga accactccac acactcacca tatgagagct
     451  ctgccaggtc aaaacacctg gtttagtggc aacacgagct ctactcaggt
     501  gattgtcgcc attgatggcc tgaagacgaa gacaacggat gccacgcccc
     551  agaacgcggt ggccgttcag gtgttctatc gagtggcgcc gagcgaactc
     601  cagagcgcaa ctggtaatgc tgaaatgcct acaaccacgc cttttgacct
     651  cccagagggg tatgaatacc tcgctgacgc gtggctccct gaccgtgcac
     701  caaccagttg atccacgagc acaaccggct tgtcaatgag ccgccaggtt
     751  tagcctggtt ccacattgac ccaccaccca tactatgaga cctaaccagt
     801  agtggtggtc gtcccgaata aagacgctaa aagatg