Sequence of DPV Macrobrachium rosenbergii nodavirus

Macrobrachium rosenbergii nodavirus segment RNA-1, complete sequence.

ACC No: AY222839

Dated: 2005-03-24 | Length: 3202 | CRC: -1943226941

                !!NA_SEQUENCE 1.0
ID   AY222839   standard; genomic RNA; VRL; 3202 BP.
XX
AC   AY222839;
XX
SV   AY222839.1
XX
DT   31-AUG-2003 (Rel. 77, Created)
DT   24-MAR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Macrobrachium rosenbergii nodavirus segment RNA-1, complete sequence.
XX
KW   .
XX
OS   Macrobrachium rosenbergii nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-3202
RX   PUBMED; 14653316.
RA   Sri Widada J., Durand S., Cambournac I., Qian D., Shi Z., Dejonghe E.,
RA   Richard V., Bonami J.R.;
RT   "Genome-based detection methods of Macrobrachium rosenbergii nodavirus, a
RT   pathogen of the giant freshwater prawn, Macrobrachium rosenbergii dot-blot,
RT   in situ hybridization and RT-PCR";
RL   J. Fish Dis. 26(10):583-590(2003).
XX
RN   [2]
RP   1-3202
RA   Bonami J.-R., Sri Widada J., Richard V.R., Vincent A., Durand S.P.;
RT   "Nucleotide sequence of the MrNV-RNA-1 of Macrobrachium rosenbergii";
RL   Unpublished.
XX
RN   [3]
RP   1-3202
RA   Bonami J.-R., Sri Widada J., Richard V.R., Vincent A., Durand S.P.;
RT   ;
RL   Submitted (22-JAN-2003) to the EMBL/GenBank/DDBJ databases.
RL   DRIM (CNRS), Universite Montpellier, Place E. Bataillon, Montpellier 34095,
RL   France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3202
FT                   /db_xref="taxon:222557"
FT                   /mol_type="genomic RNA"
FT                   /note="nodavirus of crustacean origin"
FT                   /virion
FT                   /organism="Macrobrachium rosenbergii nodavirus"
FT                   /specific_host="Macrobrachium rosenbergii"
FT                   /segment="RNA-1"
FT   CDS             24. .3161
FT                   /codon_start=1
FT                   /db_xref="GOA:Q6XNL5"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q6XNL5"
FT                   /note="A protein"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAO60068.1"
FT                   /translation="MKCNNLLYGVELPMCLQSSMGMVVVTGLAIVYLVIYILIYSFTHG
FT                   PRLSRRLASYVVIGPYEAIAKSRPAMALQRAMVDLTRRDVRTDWYPLNNLLMNKPHRLS
FT                   ENGHKTSGAVRDAARNLITSAITSLGMDKYEISPGGHTVDEQLASHRHYAVNDLHRASA
FT                   DDAVKENAVIVAIDTDYYLRDPSIYFSNNNPFILHTFQPITVAGKDGDVRFTISDNQVD
FT                   YRVDGGGRWQHKVWNWCDYGEFLYLKNILGILSINWWLSFFGIRKVIYQKIQHARPWVD
FT                   CPNRALVWGLPQFTRYMITWLPIEMNARELSRVNYQCASRPGWNCLVDHTSTKLVASIG
FT                   REGNDCHVELAKEDLDVVLGLSTMQSVTSRLLQMGYKQPQTLATVCQFYNSAAYDILSC
FT                   SIVARPSQPPVHWPLASEIDQPTTSFRNYSNNIVTCGNLCPQLKRWEVLSNSLEHRVTM
FT                   VANNKVPTPRIARFAEEYVRLVVPEANVGVPYSLEDARKELDKPTQVNAVNQIWETVDM
FT                   EVRRLIEAFVKNEPTNKSGRIISSFADSRFLLKFSTYTLAFRDEVLHAEHNRHWFCPGL
FT                   TPNEIADKVCDYVRGVATPAEGDFSNFDGRVSAWCQENVMNAVYHRWFNRKFSKELQKY
FT                   TSMLVSCPARAKRFGFQYEPGVGVKSGSPTTCDLNSVLNNFTQYAAVRLTKPDLSPQEA
FT                   FEQTGLSFGDDSLFDKQYQLRWNYVVEQLGMELKVEPFDPSNGVTFLARVFPDPYSTNT
FT                   SFQDPLRTWRKLNMTSRTCVPVESAALDRVSGYLVTDKYSPVTSEYCHMIERCYMNTAE
FT                   SVTRRRQRKDCDREKPYWLVSGGAWPQREGDYELMMRVTAARTGFEESKLINLISQFQS
FT                   VHDPWDIKPLDYQEPSPYKDTLDIDGQPVDAVDERQYQNERNTVNLRAGAAISQMPVPS
FT                   VPGGEDCNRQSADMPGPKSSEGSEQLQGLPEQDGSNRLQCHRQPTFKAKGGSNTKGRSR
FT                   KSRNGGRSISSKTANPTTHEVGGGNGKTRVTIAKRSGPKRPHNVVSNAWETLNDNR"
FT   CDS             2725. .3126
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q6XNL4"
FT                   /product="B2 protein"
FT                   /protein_id="AAO60069.1"
FT                   /translation="MQWTNVNIKMSATQSTYELVQQFPRCLSQVCQAVKTAIDSLPTCQ
FT                   DPKVAKDLSSYKACLSKMEATAFNATDNLLSKPRVVATLKGEAVNPGTEDVLSAAKQQI
FT                   QQLTRLVEAMERPELPLLSEADLSDLITW"
XX
SQ   Sequence 3202 BP; 927 A; 679 C; 736 G; 859 T; 1 other;

 AY222839  Length: 3202  March 29, 2005 13:35  Type: N  Check: 4431  ..

       1  gttaaacgtt ttgttttcta gcaatgaagt gcaataatct tctctacggt
      51  gtggaactcc ccatgtgctt gcaatcgagc atgggcatgg tggttgttac
     101  cggactcgcc atagtgtatt tggtaattta catcctcatt tactcattta
     151  cacatggacc acgactcagc cgcagattag cttcctatgt ggtaatcgga
     201  ccttatgaag ctattgctaa aagccgaccc gcgatggccc tacaaagggc
     251  catggttgat ttgacacgac gggacgtgcg tactgactgg tacccattga
     301  ataatttgtt gatgaacaaa cctcaccgct tatctgaaaa tggacacaaa
     351  acttctggag cggttcgaga tgcagctaga aatttaatta ctagcgctat
     401  aacatcactg ggtatggata agtatgaaat atcaccaggt ggccacactg
     451  tcgacgagca attggcatct catcgacatt atgctgttaa tgacttacat
     501  cgagcatcag cagatgacgc agttaaagaa aacgctgtca ttgtggctat
     551  tgatacggac tactatctac gtgatccatc aatctacttt tcaaataata
     601  atccatttat tctgcatact tttcaaccaa taactgttgc aggtaaagat
     651  ggagatgtga ggttcactat tagtgacaac caagtggact atagggtaga
     701  tggtggtggt aggtggcaac ataaagtttg gaattggtgt gattatggtg
     751  aattcctata tttaaagaac atcctaggta ttcttagcat taattggtgg
     801  ctaagtttct ttggtatcag aaaggttata taccaaaaga tccaacacgc
     851  acgtccctgg gtggattgtc cgaaccgggc cttagtttgg ggattacctc
     901  aattcactag gtatatgatw acttggttgc caattgagat gaacgcacgt
     951  gaattgagta gagtcaacta tcagtgtgct agcagacctg gctggaattg
    1001  tttagttgac cacactagca ccaaacttgt agccagcata ggtcgagagg
    1051  gtaatgactg tcatgttgaa cttgctaagg aggacttaga tgttgttcta
    1101  ggcttaagta ccatgcagtc agttacttca agacttttac aaatgggtta
    1151  caagcaacca caaactttgg ctacggtttg tcagttctac aacagtgccg
    1201  cttatgatat actaagctgt agcatagttg ctagaccttc acaaccacct
    1251  gtccactggc cattggcgtc tgaaattgat cagcctacaa cttcttttcg
    1301  taattactcc aacaatattg tgacctgtgg taatctttgc ccccaactta
    1351  aacgttggga ggttttaagt aattctttag aacatcgtgt taccatggtg
    1401  gccaataata aggttccaac acctcgcata gccaggtttg ctgaagaata
    1451  cgtccgcctg gtagttcccg aagcgaatgt aggtgtacct tatagtttgg
    1501  aagatgcgcg taaagaactt gataaaccca cgcaagtcaa tgcggtaaac
    1551  caaatttggg aaacagtcga catggaagtc cgccgattaa ttgaagcatt
    1601  tgtgaagaat gaaccgacca ataaatctgg tcgcataata tcatcctttg
    1651  cggactcaag attcttgttg aaattttcca catatacgct tgcctttcga
    1701  gatgaagtat tacatgctga acataatcga cattggtttt gtcctggatt
    1751  gacacctaat gagatagcag ataaagtctg cgactatgtt cgtggtgttg
    1801  cgacacctgc agaaggtgat tttagcaact ttgacggaag agtatctgct
    1851  tggtgtcaag agaacgtgat gaatgcggtt taccatagat ggtttaaccg
    1901  taagttttcc aaggaattgc agaagtatac atcaatgttg gttagttgcc
    1951  cagctcgagc taagcgtttt ggtttccaat atgaaccggg agtgggggtt
    2001  aagagtggta gtccaaccac ctgtgacctt aattcagttc taaataactt
    2051  cactcaatac gcagcagtta ggctgactaa accagacctc tcaccacaag
    2101  aagcctttga acaaactggc ttaagtttcg gcgacgattc actatttgac
    2151  aagcaatatc aactcagatg gaattacgtc gtcgaacaac ttggtatgga
    2201  actcaaggtt gaaccctttg accccagtaa tggtgtgact tttcttgctc
    2251  gtgtttttcc tgatccttat agtacaaaca ctagttttca ggatccacta
    2301  agaacgtgga gaaagttgaa catgacttca cgcacgtgtg tacctgtcga
    2351  gtcagcagct cttgatcgtg tcagtggata tttagtaact gacaagtact
    2401  ctccagtaac aagtgagtac tgtcacatga ttgagaggtg ttatatgaac
    2451  actgccgaaa gtgtaactcg aaggagacaa cgcaaggatt gtgaccgtga
    2501  gaaaccatac tggttagtga gtggtggcgc ctggccccag agggaggggg
    2551  actatgaatt gatgatgagg gttaccgcag cccgtactgg atttgaggag
    2601  tcaaaactta ttaatttgat tagccagttc caatcagttc atgatccttg
    2651  ggacatcaaa ccgctagact atcaggaacc atcaccttat aaagacacac
    2701  tagacataga tggccagccg gtagatgcag tggacgaacg tcaatatcaa
    2751  aatgagcgca acacagtcaa cttacgagct ggtgcagcaa tttcccagat
    2801  gcctgtccca agtgtgccag gcggtgaaga ctgcaatcga cagtctgccg
    2851  acatgccagg acccaaaagt agcgaaggat ctgagcagct acaaggcttg
    2901  cctgagcaag atggaagcaa ccgccttcaa tgccaccgac aacctacttt
    2951  caaagccaag ggtggtagca acactaaagg gagaagccgt aaatcccgga
    3001  acggaggacg ttctatcagc agcaaaacag caaatccaac aactcacgag
    3051  gttggtggag gcaatggaaa gaccagagtt accattgcta agcgaagcgg
    3101  acctaagcga cctcataacg tggtaagcaa tgcctgggaa actctgaatg
    3151  acaaccgata aactctctct ttctctctct ccaagtctcc ttcactcttt
    3201  cg