Sequence of DPV Macrobrachium rosenbergii nodavirus

Macrobrachium rosenbergii nodavirus segment RNA-2, complete sequence.

ACC No: AY222840

Dated: 2005-03-24 | Length: 1175 | CRC: -1001389480

                !!NA_SEQUENCE 1.0
ID   AY222840   standard; genomic RNA; VRL; 1175 BP.
XX
AC   AY222840;
XX
SV   AY222840.1
XX
DT   31-AUG-2003 (Rel. 77, Created)
DT   24-MAR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Macrobrachium rosenbergii nodavirus segment RNA-2, complete sequence.
XX
KW   .
XX
OS   Macrobrachium rosenbergii nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-1175
RX   PUBMED; 14653316.
RA   Sri Widada J., Durand S., Cambournac I., Qian D., Shi Z., Dejonghe E.,
RA   Richard V., Bonami J.R.;
RT   "Genome-based detection methods of Macrobrachium rosenbergii nodavirus, a
RT   pathogen of the giant freshwater prawn, Macrobrachium rosenbergii dot-blot,
RT   in situ hybridization and RT-PCR";
RL   J. Fish Dis. 26(10):583-590(2003).
XX
RN   [2]
RP   1-1175
RA   Sri Widada J., Bonami J.-R., Richard V.R.;
RT   "Nucleotide sequence of the MrNV-RNA-2 of Macrobrachium rosenbergii";
RL   Unpublished.
XX
RN   [3]
RP   1-1175
RA   Sri Widada J., Bonami J.-R., Richard V.R.;
RT   ;
RL   Submitted (22-JAN-2003) to the EMBL/GenBank/DDBJ databases.
RL   DRIM (CNRS), Universite Montpellier, Place E. Bataillon, Montpellier 34095,
RL   France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1175
FT                   /db_xref="taxon:222557"
FT                   /mol_type="genomic RNA"
FT                   /note="nodavirus of crustacean origin"
FT                   /virion
FT                   /organism="Macrobrachium rosenbergii nodavirus"
FT                   /specific_host="Macrobrachium rosenbergii"
FT                   /segment="RNA-2"
FT   CDS             38. .1153
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q6XNL3"
FT                   /product="capsid protein"
FT                   /protein_id="AAO60070.1"
FT                   /translation="MARGKQNSNQIQNNSNANGKRRKRNRRNRNPQTVPNFNPIVAKPT
FT                   VAPLQTNIRSARSDVNAITVLNGSDFLTTVKVRGSNNLTDSKSRILVKQPISASSFLGT
FT                   RISGLSQFWERYRWHKAAVRYVPAVPNTLACQLIGYIDTDPLDDPNVILDVDQLLRQAT
FT                   SQVGARQWNFSDTTTIPLIVRRDDQLYYTGQDKENVRFSQQGVFYLLQVTTLLNISGEA
FT                   ITNDLISGSLYLDWVCGFSMPQINPTPVEVSQLTYNADTIGNWVPPTELKQTYTQDITG
FT                   LKPNSKFIIVPYMDRVSSEVLQKCTITCNEVDAVGSISYFDTSAIKCDGYISFQANSIG
FT                   EATFTLVTDYQGAVDPKPYQYRIIRAIVGNN"
XX
SQ   Sequence 1175 BP; 352 A; 242 C; 231 G; 350 T; 0 other;

 AY222840  Length: 1175  March 29, 2005 13:35  Type: N  Check: 6781  ..

       1  aaaggatatt cgatattcta tcatctttaa catcaagatg gctagaggta
      51  aacaaaattc taatcagatt caaaacaata gtaacgcaaa cggcaagcgc
     101  cgtaagcgta atcgaaggaa tcgcaatccg cagacggttc ccaactttaa
     151  ccccattgtc gcaaagccga cggttgcccc acttcaaact aacattagaa
     201  gtgctaggag tgacgttaat gccatcactg ttttaaatgg cagtgatttt
     251  cttacaactg tcaaagtccg aggttctaac aatttaactg attccaagtc
     301  tagaatcttg gttaagcaac caatttctgc gagttctttt cttggtacca
     351  gaatttctgg tctatcgcaa ttttgggagc gttatagatg gcacaaggct
     401  gcagttagat atgttcctgc agtacccaat actttagctt gccaacttat
     451  tggttacatc gatacagatc cactagatga ccccaacgtt atcctcgatg
     501  tcgatcagtt acttaggcag gctacgtcac aagtgggtgc gcggcagtgg
     551  aatttctctg atacaacaac tattccattg attgtcaggc gtgatgatca
     601  attgtactat actggtcaag ataaagagaa cgttcgtttc tctcaacagg
     651  gtgtatttta cctcttgcaa gtgactacac tacttaatat tagtggtgaa
     701  gccattacaa atgatttaat ttcaggttca ctatatttag attgggtctg
     751  tggattttcc atgccacaaa ttaatcctac accagtggaa gtttcacagc
     801  taacttacaa tgcggatact attggcaatt gggttccacc aacagaactc
     851  aagcaaactt atactcaaga tattactggt ttgaagccaa attctaaatt
     901  tattatcgta ccctatatgg atagagtaag ttctgaagta ctgcagaagt
     951  gcacaatcac ttgtaatgag gttgacgcag ttggttcaat ctcatatttc
    1001  gatactagcg ctatcaaatg tgatgggtac atatcatttc aggccaatag
    1051  cattggtgaa gcaaccttca ccttagtgac cgattatcag ggtgcggttg
    1101  accctaaacc ctatcagtat aggattatca gagctatcgt cggcaataat
    1151  taggttgtca tatctagcac atgat