Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate DS1-SR p20 protein gene, complete cds.

ACC No: AY263360

Dated: 2003-05-13 | Length: 549 | CRC: 60536174

                !!NA_SEQUENCE 1.0
ID   AY263360   standard; RNA; VRL; 549 BP.
XX
AC   AY263360;
XX
SV   AY263360.1
XX
DT   13-MAY-2003 (Rel. 75, Created)
DT   13-MAY-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate DS1-SR p20 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Davino S., Davino M., Sambade A., Guardo M., Caruso A.;
RT   "The first citrus tristeza virus outbreak found in a relevant citrus
RT   producing area of Sicily, Italy";
RL   Plant Dis. 87:314-314(2003).
XX
RN   [2]
RP   1-549
RA   Davino S., Guardo M., Caruso A., Davino M.;
RT   ;
RL   Submitted (27-MAR-2003) to the EMBL/GenBank/DDBJ databases.
RL   DiSTeF-Patologia Vegetale, Universita degli Studi di Catania, Via S. Sofia,
RL   100, Catania, CT 95100, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="DS1-SR"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /protein_id="AAP32158.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 133 A; 110 C; 142 G; 164 T; 0 other;

  AY263360  Length: 549  May 20, 2003 09:41  Type: N  Check: 5981  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  tggttcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcag gatggtcacc atgagatggg
     201  tgaacataaa tctcggttgt tgtgcaatat agaggcgaaa ctgcgagtgc
     251  ttctcgacat cataagacgt cggtttactc gcgaaaaact gctctgtacc
     301  agtgctacag atgttgtggg cttcttcgtc gtgaggtaca tgagttctag
     351  tcacactagt ttcgaaaccg taatgcgaac ggaactgaag ttggtggtta
     401  aagctgtgct gtcggaattg tcccgcacgc ataaactaga ttttagcgag
     451  cgagccttta cggcttacgg tatccttttg cagaagggca ccgtggcaac
     501  cgtttgcggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag