Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate DS2-CT p20 protein gene, complete cds.

ACC No: AY263361

Dated: 2005-04-16 | Length: 549 | CRC: -1285296443

                !!NA_SEQUENCE 1.0
ID   AY263361   standard; genomic RNA; VRL; 549 BP.
XX
AC   AY263361;
XX
SV   AY263361.1
XX
DT   13-MAY-2003 (Rel. 75, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate DS2-CT p20 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Davino S., Guardo M., Sorrentino G., Sambade A., Caruso A., Davino M.;
RT   "Severe infections of Citrus tristeza virus found in Sicily on 'Tarocco'
RT   sweet orange";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Davino S., Guardo M., Caruso A., Davino M.;
RT   ;
RL   Submitted (27-MAR-2003) to the EMBL/GenBank/DDBJ databases.
RL   DiSTeF-Patologia Vegetale, Universita degli Studi di Catania, Via S. Sofia,
RL   100, Catania, CT 95100, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="DS2-CT"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProt/TrEMBL:O10477"
FT                   /product="p20 protein"
FT                   /protein_id="AAP32159.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 135 A; 113 C; 140 G; 161 T; 0 other;

 AY263361  Length: 549  April 19, 2005 08:56  Type: N  Check: 3514  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  cggcgcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcag gatggtcacc atgagatggg
     201  tgaacacaag tctcgattgt tgtgcaatat agaggcgaaa ctgcgaatac
     251  ttctcgatat cataagacgt cggtttactc gcgacaagct gctctgtacc
     301  agcgcaacag atgtcatggg cttcttcgtt atgaggtaca tgagttctag
     351  tcacaccagt ttcgagtccg taatgcgaac ggagctgaaa ttagtggtta
     401  aagcggtatt gtcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagcctttg cggcttacgg tatccttttg caaaagggta ctgtagcgac
     501  cgtttgcggt cagtttgaca ttaatttagt ctctccatct tgcgtgtag