Sequence of DPV Cryphonectria cubensis mitovirus 1c

Cryphonectria cubensis mitovirus 1c RNA-dependent RNA polymerase gene, complete cds.

ACC No: AY328478

Dated: 2004-07-02 | Length: 2501 | CRC: 983746525

                !!NA_SEQUENCE 1.0
ID   AY328478   standard; genomic RNA; VRL; 2501 BP.
XX
AC   AY328478;
XX
SV   AY328478.1
XX
DT   02-JUL-2004 (Rel. 80, Created)
DT   02-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Cryphonectria cubensis mitovirus 1c RNA-dependent RNA polymerase gene,
DE   complete cds.
XX
KW   .
XX
OS   Cryphonectria cubensis mitovirus 1c
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus.
XX
RN   [1]
RP   1-2501
RA   van Heerden S.W., Preisig O., Wingfield B.D., Wingfield M.J.;
RT   "Molecular characterization of mitoviruses co-infecting South African
RT   isolates of the Eucalyptus canker pathogen Cryphonectria cubensis";
RL   Unpublished.
XX
RN   [2]
RP   1-2501
RA   van Heerden S.W., Preisig O., Wingfield B.D., Wingfield M.J.;
RT   ;
RL   Submitted (24-JUN-2003) to the EMBL/GenBank/DDBJ databases.
RL   Department of Genetics, Forestry and Agricultural Biotechnology Institute,
RL   University of Pretoria, Pretoria, Gauteng 0001, Republic of South Africa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2501
FT                   /db_xref="taxon:249054"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cryphonectria cubensis mitovirus 1c"
FT   CDS             84. .2318
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q6EH19"
FT                   /transl_table=4
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAR01972.1"
FT                   /translation="MTKADHYSSASSDPPRWTDCCHNTRQHQPTFAIKWIITKTMKRNL
FT                   NKLYIHLNLLRDIGAIKLSLVWFLHWSHLELGIASRLVSSAVARFQLLATTRGRNAAIS
FT                   EFKASRLAFTRWLCGRPLSGKVGAPITKAGLPKVIPREARLLLLRERPLYLVKAVITVL
FT                   SIGRYFKGGNPVKWENITKPSTPTLPKDGEILFGLEKLNIDVGQFEPTDWKFRWVVTAG
FT                   PNGPSISSCLQDLPKFNGLFRSQVEVILPELLPIIDTLLTWEKSFKLSTLMGLAGFKDD
FT                   SLRKIAIKDDREGKSRPFAIFDYWSQTVLSPLHDWAYATLRSIPQDCTFNQAEGLSKVT
FT                   ARPSQKYFYSYDLEAATDRFPIQFQKKVLSLIFNTTYAQAWAEIMTQEPFRVKGLSDPL
FT                   RWGAGQPLGAKSSWAIFTLCHHLVVHIAAVRTNSDPYYVILGDDIVLRGSRLATVYKRI
FT                   MSELGVSISETKSHVSKDTFEFAKMWMHQGRNASGFPVVGLAETLRKPLEMAALFVFEL
FT                   PAKGYPVTITPRTVSQYFLLVARYNTIPPRLAVWTADKVVWYYSFLSWLATRDDGWAKY
FT                   IAQSASLLVSPNTAHDLLMKAVRDKWAKQLDKSLMDFQDFGFDMFDKVKTLPPFKPTWD
FT                   PEAWPGRLSASGIEFNPAPRKVPIFAALQEEGEIKYSDYLQQKLEMTDDQLTFEEIESL
FT                   KLPPRPQLKGFLPKRTREYVRTLNLISHGLNRDLRAQCIGTRPDVYNMKD"
XX
SQ   Sequence 2501 BP; 685 A; 612 C; 591 G; 613 T; 0 other;

AY328478  Length: 2501  October 20, 2004 11:42  Type: N  Check: 9214  ..

       1  cttttccttt ttcttttttt ttttatccgt tccgtgtcca ctagctgctg
      51  actgttactg actagccttg taacaacaaa gggataacca aagctgacca
     101  ctactcaagt gcgagcagcg acccgccaag gtgaaccgat tgctgtcata
     151  atactaggca gcaccagccc acgtttgcta taaaatgaat tataacaaaa
     201  accatgaaaa gaaatctcaa taaactctat atacacctaa atctcttacg
     251  agacatcggt gcaataaaat tgagtctagt gtgattcctt cactgatccc
     301  accttgagct aggtatagcg tcacgtctcg tctcttccgc ggtagccaga
     351  tttcaacttc tggccaccac gagagggcgg aacgccgcta tatccgagtt
     401  taaggcgtcg cggctagcgt ttacacgatg actctgtggg cggccgctct
     451  caggtaaagt tggtgccccg ataacaaaag ctgggcttcc taaggtaatc
     501  cctagggagg ccagactttt gttgcttcgg gaacgccctc tttacttggt
     551  aaaggccgtc ataacggtgc tatcgatcgg gcgttatttt aagggtggaa
     601  accctgtaaa gtgggagaat attacgaagc cgtcaactcc taccctccca
     651  aaagatggag aaatcctctt tgggttggag aagttgaaca ttgacgtcgg
     701  gcagttcgag ccaacggatt ggaaattccg ttgagtcgtg acagccgggc
     751  caaatgggcc aagtatatct tcctgcttac aggacctccc gaaatttaac
     801  ggtctcttca ggtcccaggt agaagtcatt ctacctgagc tccttcccat
     851  cattgatacc ctattgacct gggagaaaag ctttaagctg tcaaccctta
     901  tgggattggc aggctttaaa gacgattccc tccggaaaat agctatcaag
     951  gatgataggg agggtaagag tagacctttt gcgatattcg attactgatc
    1001  ccagacagtt ttatcacctc tgcatgactg agcgtacgcg accctgaggt
    1051  caattcctca ggattgcacg ttcaaccagg cagagggact gtcgaaggtc
    1101  acagctcggc catcgcaaaa gtatttctat tcttacgacc ttgaagcggc
    1151  aacagaccgt tttccgatac aatttcagaa aaaggttctg tccctgatct
    1201  ttaacactac ttatgcccag gcgtgagctg agataatgac tcaagagcct
    1251  tttagagtca agggattgtc cgacccctta agatgaggag ccgggcagcc
    1301  tcttggagct aaaagttcct gagccatttt cacattatgc caccacctag
    1351  tagttcatat agcagcggta cggactaact ccgaccccta ctacgtgata
    1401  ctaggcgatg acatagtgct ccgtggctca cggctggcga cagtgtacaa
    1451  acggataatg tccgaacttg gagtatccat atccgaaacg aaatcgcacg
    1501  tgtcaaaaga cacgttcgaa ttcgctaaga tgtgaatgca ccaaggtagg
    1551  aacgcgagtg ggttccctgt agtgggacta gctgagacac tcagaaagcc
    1601  actagaaatg gcggctctct ttgtgtttga gctccctgct aaagggtatc
    1651  cagtcactat tactccgcgc accgtgtcgc agtacttcct tctagtagca
    1701  cgttataata ccattccacc tcgtctggcg gtatgaactg ccgacaaagt
    1751  ggtatggtac tatagtttct tgtcatgact ggccacccgg gatgacggat
    1801  gggcgaaata tatcgcccag tcggcctccc tattggtgag ccccaatacc
    1851  gcccacgacc tccttatgaa ggccgtgaga gataaatggg ctaaacagct
    1901  tgacaagtct ctaatggatt tccaggattt tggatttgat atgttcgaca
    1951  aagtgaagac cttgccgcca ttcaagccta cctgggatcc agaagcgtga
    2001  cctggtcggt tgtctgcgag tggaatcgaa ttcaatccag cccctaggaa
    2051  ggtaccaata tttgctgctc tccaagaaga aggagagatc aagtattccg
    2101  attatctcca acagaagttg gagatgaccg acgatcagct gacgttcgag
    2151  gagatagaat ctttgaaact acctcctcgt ccgcaactga aagggttcct
    2201  tccgaaaagg actagagagt atgttcgtac acttaaccta attagtcacg
    2251  gcttaaaccg ggatctaagg gctcagtgca taggaaccag accagacgta
    2301  tacaatatga aagactaaga ggttctccct cccaccttga gaaagtggtg
    2351  aaagctctcc ttagccccta cacattgtgt acccccattc ccctttcggg
    2401  gtaggcagaa gtcaactgct tgctccggca gggatgccgg atgggaagtc
    2451  gacagcgctg gggcaaaaaa aaaaaaaaaa aaaagaaaaa aaaaagaaaa
    2501  a