Sequence of DPV Cryphonectria cubensis mitovirus 2a

Cryphonectria cubensis mitovirus 2a RNA-dependent RNA polymerase gene, complete cds.

ACC No: AY328479

Dated: 2004-07-02 | Length: 2639 | CRC: -846586005

                !!NA_SEQUENCE 1.0
ID   AY328479   standard; genomic RNA; VRL; 2639 BP.
XX
AC   AY328479;
XX
SV   AY328479.1
XX
DT   02-JUL-2004 (Rel. 80, Created)
DT   02-JUL-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Cryphonectria cubensis mitovirus 2a RNA-dependent RNA polymerase gene,
DE   complete cds.
XX
KW   .
XX
OS   Cryphonectria cubensis mitovirus 2a
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus.
XX
RN   [1]
RP   1-2639
RA   van Heerden S.W., Preisig O., Wingfield B.D., Wingfield M.J.;
RT   "Molecular characterization of mitoviruses co-infecting South African
RT   isolates of the Eucalyptus canker pathogen Cryphonectria cubensis";
RL   Unpublished.
XX
RN   [2]
RP   1-2639
RA   van Heerden S.W., Preisig O., Wingfield B.D., Wingfield M.J.;
RT   ;
RL   Submitted (24-JUN-2003) to the EMBL/GenBank/DDBJ databases.
RL   Department of Genetics, Forestry and Agricultural Biotechnology Institute,
RL   University of Pretoria, Pretoria, Gauteng 0001, Republic of South Africa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2639
FT                   /db_xref="taxon:249055"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cryphonectria cubensis mitovirus 2a"
FT   CDS             893. .2563
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q6EH18"
FT                   /transl_table=4
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAR01973.1"
FT                   /translation="MKLRLKGSLKAGPNGKISLLTSLLDALAFWSDPLRVIHFIWFNIR
FT                   CYGYFWGLIWSMWLIFIMIISLPYYLIALCLGARAPVMGQLATVYDQAGKARIVASTNS
FT                   WIQCSLFGLHNKIFSILRSIPQDGTFDQNKPFDLLLESLQPGYMLYGFDLSAATDRLPI
FT                   AFQKDILNHLGYPGGPWRRLLGIKYNSPCGFISYAVGQPMGAYSSFAMLALTHHVLVQV
FT                   AAQKAGFSDRFTDYCILGDDIVIANSLVAEAYKSLIFDLGLEISESKSVISGTFTEFAK
FT                   KLRGPLMDISPIGAGLILYSLRNKYYICVLVFEILERGLCMWYDVYPQLLSLLPKIYRR
FT                   YFKLCDWFIALHLRRREHLGDQDHEILNPRIAYFNVFLNKEKIISLLEIMWNSTVRDWF
FT                   RLWNSIKYTLNKGLFISQARVGLPDWSELIFFPLLPSTYIMIMSYATSLNDISKAFGNW
FT                   WLLNSLEKDQINIFDVIAMMERESILDLDINDKKKVKLSLDNLYKLNSIINRTGAGLEI
FT                   FIDRWRKTSFRLMTYKSLTASSLSDIPFSILSFDENGKL"
XX
SQ   Sequence 2639 BP; 748 A; 481 C; 510 G; 899 T; 1 other;

AY328479  Length: 2639  October 20, 2004 11:42  Type: N  Check: 8849  ..

       1  ctttttttgt tttttttttc ttttctttgg ggtaatgact cttcaagtca
      51  cttgacagtc ataatgccta aaccccagtc agtctctctt gccttcacag
     101  gtgaggtgtg ctttcggcta taatggtact ttccattcgg acagtagacg
     151  agtgtaatga gataacatca aaattcgaat tgcacgggct agcgacccaa
     201  cgtaatagta aatcactcca aactgtatcg tgaaacattt gcattaatta
     251  attaacacaa agctacaaca acacattcaa aattatactc taaacttaat
     301  gcaaaattga gtctaataag aagtaactat ttttctttgt tacttttatt
     351  aaaatcattc ttcatcaagc ctaaaagtgt taatgtcaaa cgtgatggta
     401  agagctggat ctcccaaaag gagattccaa aatttatcat catggtttgt
     451  tggtgtaccg gtacacagtc ctatcaaaga tcttttatga agatgcagga
     501  tagatttgtc tttatctgaa atactgctgg ctctacattc ctctttaagt
     551  atcttaaaga ggtaatgcgt cttacagtaa gaagattggc gaatatagac
     601  cttattccta gtaaagaaaa tctttgttaa attaaacaaa tatagatttc
     651  ctgctattat tcctctagag atttgcaagg atctttcctg gtttccaggg
     701  agattccatg ttttgtctcg aaaggtaata gctctcctta ccgttatttc
     751  gattttcagg gttttaccta ctaaggtatt gcctgattac acgactatca
     801  gtaagcccca ttcgggactt attgaaacgt gttcatcaga gtcaattgct
     851  ttagcctgta aaaatcttga gatcaaaaga gttgataagg tgatgaagct
     901  aagattgaaa ggttctctaa aagccggacc gaatggtaaa atatcattac
     951  ttacttcgtt attagatgct ctggcttttt ggtcagatcc tttaagggta
    1001  atccacttca tctgatttaa tatcaggtgt tatggttact tttggggact
    1051  aatatgaagt atgtgattga tttttatcat gatcatttcc ttaccgtatt
    1101  accttatagc attgtgtctt ggtgcgagag ccccagtaat gggtcaattg
    1151  gcaactgttt atgatcaagc tggaaaagcg agaattgtag cttctacaaa
    1201  ctcgtggatt cagtgttctc tctttggttt acacaataag attttttcta
    1251  tcttacggag tattcctcaa gatggaactt ttgatcaaaa caagcctttt
    1301  gatttattat tggagtctct tcagccaggg tacatgttat atggtttcga
    1351  cctgagtgca gcgacagata gacttcctat tgcattccaa aaggatatcc
    1401  taaatcattt agggtatccc ggaggtcctt gaagaaggtt actgggtatc
    1451  aaatataatt caccttgtgg atttatttct tacgcagttg gccaaccaat
    1501  gggtgcatat tcttcctttg caatgcttgc tcttacacat cacgtgttgg
    1551  ttcaagtagc cgcccaaaag gcgggtttct cagaccgttt cacggactac
    1601  tgtattcttg gtgacgatat cgtcatagcc aactctttag ttgctgaagc
    1651  ttataagtcc ttaatctttg atttaggctt agaaatttca gaatctaaga
    1701  gtgttatttc cggaacattt accgaattcg caaagaagtt gagaggtcca
    1751  cttatggata tctcacctat cggagcgggt ttgatattat attccttacg
    1801  taacaagtac tacatctgtg tgttggtttt tgagatcctg gaaaggggat
    1851  tatgcatgtg gtatgacgtc tacccccaat tactcagctt gttacctaag
    1901  atttatcgta ggtatttcaa gctttgtgat tggtttattg cgcttcactt
    1951  gcgtcggaga gagcatctgg gtgaccaaga tcatgagatc ttgaatccta
    2001  gaattgctta cttcaacgta ttcttaaata aagagaagat tatctcttta
    2051  cttgagatta tgtgaaactc tactgtaagg gattggttcc gattatggaa
    2101  ttcgattaag tatactctaa ataagggtct atttatatct caagccagag
    2151  tcggtcttcc ggactgaagt gaattgatct tctttccttt gttaccctcn
    2201  acttatatta tgatcatgtc ctacgcaacg tccctgaatg acatttccaa
    2251  agcttttgga aattgatgac ttctcaattc tctcgagaag gaccagatta
    2301  acatcttcga tgtaatcgcc atgatggaac gtgagtcaat acttgatctt
    2351  gatataaatg ataagaagaa ggttaaatta tctttggata atctatataa
    2401  gttaaattct ataatcaata ggactggagc agggctggaa atctttatag
    2451  atcgttggcg gaaaacttca ttccgtttaa tgacctataa aagcctaaca
    2501  gcttcttctc tgtccgatat accctttagc attcttagtt ttgacgagaa
    2551  tggcaaattg taatagaatc taaccaacat gggatcgagg tctacacact
    2601  tcagtgtgcc ttgtgtacct gagctgatgt tgcttagga