Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Qaha from Egypt, complete genome.

ACC No: AY340974

Dated: 2003-08-03 | Length: 19296 | CRC: 1692616941

                !!NA_SEQUENCE 1.0
ID   AY340974   standard; DNA; VRL; 19296 BP.
XX
AC   AY340974;
XX
SV   AY340974.1
XX
DT   03-AUG-2003 (Rel. 76, Created)
DT   03-AUG-2003 (Rel. 76, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Qaha from Egypt, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19296
RA   Abdelmaksoud H.M., Gamal El-din A.S.;
RT   "Complete Nucleotide Sequence of Citrus Tristeza Virus Qaha isolate";
RL   Unpublished.
XX
RN   [2]
RP   1-19296
RA   Abdelmaksoud H.M., Gamal El-din A.S.;
RT   ;
RL   Submitted (07-JUL-2003) to the EMBL/GenBank/DDBJ databases.
RL   Plant Virology Research Department, Plant Pathology Research Institute, 9
RL   Gamma Str, Giza 12619, Egypt
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19296
FT                   /country="Egypt"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic DNA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Qaha"
FT   5'UTR           1. .107
FT   misc_feature    108. .9482
FT                   /note="similar to papain-like leader protease"
FT   misc_feature    <9355. .10857
FT                   /note="similar to RNA polymerases from other
FT                   closteroviruses"
FT   CDS             10906. .11814
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /protein_id="AAQ02637.1"
FT                   /translation="MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIGVGYDTTDR
FT                   DPTVLADYFSLYFFLLNNDSVGPIAASIEVSPPVSGTHKIRAHIDNQPNCEGNVTYVKT
FT                   FDKSRFVIRVKASPSMRGYYSFRVFLCSDVASERSEFVCSFVGSRFLCCWKQTISENLS
FT                   KVCSSSFFFRAVSERATNEFSVATDDVEDVKYIRKQAEGFSRCADPYVPRCYRSTNLGD
FT                   SSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVPPYIAGYNENARSRVSLIRRVCCY
FT                   AVCVLVVSVHLMSGLLAIIFI"
FT   CDS             11888. .12043
FT                   /codon_start=1
FT                   /note="similar to small hydrophobic protein from
FT                   closteroviruses"
FT                   /product="putative membrane protein"
FT                   /protein_id="AAQ02638.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFCAFAGLIIFVITIYRCTIKPVRSASPY
FT                   GTHATV"
FT   CDS             12049. .13833
FT                   /codon_start=1
FT                   /note="similar to HSP70 proteins"
FT                   /product="heat shock protein 70"
FT                   /protein_id="AAQ02639.1"
FT                   /translation="MVLLGLDFGTTFSKVAMATPSELVILKQSNSSYIPTCLLLHAEPN
FT                   SVSYANDAEYLAASGESGSFYKDLKRWIGCTAKNYQTYLHKLSPSYKVIVKEFGTKSVP
FT                   VPYLSPLNNDLGLSVGLPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLNSADKYLAIYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSSGDMNLGGRDIDKKLSDKIYQMADFVPQKELNVSSLKEALSLQTDPVKYTVNHYG
FT                   MSETVSIDLSVLREIASVFINRTIDILTKVKVKSSMPESQSLKLVVVGGSSYLPGLLDA
FT                   LATVPFVSGIVPVEDARTAVATGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGEQKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASISLFTLGVNWS
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELDNVQGTSHYDYAGMPHPTRKLVRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLANLRKTASLGEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13757. .15364
FT                   /codon_start=1
FT                   /product="hypothetical protein"
FT                   /protein_id="AAQ02640.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDQALSSG
FT                   VVVRRQSLLNAPQGTFENGLALLYNSVVINDFVELTGMPLKSLMTGIEDRKLPDELISV
FT                   DPHEVGCRFTLNDVESYLMSRGEDFADLAAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HADNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPMDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDLRLAADNPD
FT                   LRVGLRWAGMFVYYGVYRCVVDRAVERPTLFRLPQKLLSQDDGESCSLHMGSVEALFNL
FT                   VQKVNKDINVRRQFMGRHSEVALRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRVPDG
FT                   AVTADELESLRQLRSSVDVMCKDSLSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPFHGRLYSTS"
FT   CDS             15339. .16061
FT                   /codon_start=1
FT                   /note="divergent compared to coat proteins from other
FT                   closteroviruses"
FT                   /product="coat protein"
FT                   /protein_id="AAQ02641.1"
FT                   /translation="MAGYTVLPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTPSIYEDSTEKFTGEHLKYVMVTMDTFLLENYKTKTEDLLVHLTMIQKRLYTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKFACTFEELHL
FT                   CMARLRPDLYENKRTTRAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16155. .16826
FT                   /codon_start=1
FT                   /product="CP"
FT                   /protein_id="AAQ02642.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFRIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDVVVTNVRQLGKFNT
FT                   R"
FT   misc_feature    16791. .17294
FT                   /note="similar to 18 kDa protein"
FT   CDS             17329. .17688
FT                   /codon_start=1
FT                   /product="13 kDa protein"
FT                   /protein_id="AAQ02643.1"
FT                   /translation="MSIRRSWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFT
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRADRTNVSEIVESHVSDRDRMSILL
FT                   RNKRIQIPSLLPCDN"
FT   misc_feature    17716
FT                   /note="subgenomic RNA transcription start site"
FT   CDS             17764. .18312
FT                   /codon_start=1
FT                   /note="20 kDa"
FT                   /product="hypothetical protein"
FT                   /protein_id="AAQ02644.1"
FT                   /translation="MRAYFSVNDYISLLAKVSAVVERLCDPSVTLAEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELRLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   misc_feature    18356
FT                   /note="subgenomic RNA transcription start site"
FT   CDS             18394. .19023
FT                   /codon_start=1
FT                   /note="23 kDa"
FT                   /product="hypothetical protein"
FT                   /protein_id="AAQ02645.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTATTDVEPVSSEADRLDFLQKMNPII
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19024. .19296
XX
SQ   Sequence 19296 BP; 4702 A; 3873 C; 4860 G; 5861 T; 0 other;

AY340974  Length: 19296  August 12, 2003 09:41  Type: N  Check: 8115  ..

       1  aatttcacaa attcatcctc ttcccccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacggaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gcaatcgctg
     151  ttaacatcga ttacacgata tcgcgcatct ggcgcaaact taacaccata
     201  gtagtcctgc actactttgg ttttgttaga atcaccaagg tgattcgtga
     251  caaatcagct gatatgccga tagtcccttt acggaaatct gtatttccgt
     301  tttctgttcg cgcggctgtc acgagcttgg tgctgctggg cgtcctcttg
     351  acgctccgca ttcagggtgc ctctgtggcc ttcccgttat caacgcatct
     401  ggcgttgttc gtccccgctc tgttcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc gctcacctct gccgctaaga ggtccctccg tcaggcaaag
     501  cgggaatctg tttcattttc tagccgggcc tcttctcgct tctctaggga
     551  agtccctcgc ggccaacgtt caagacttca cagacgtgtg gtgagacgag
     601  ctgacactgc cccagtgtag agtccccaag acaagcctac ccgacgaaac
     651  agccgacttg gtaagacttc tcacctccct tacgtggggg aggcagcgtt
     701  ggatgatatc cttcgctgga tcgaagaggt taatcctcat ccctcgatgg
     751  tcgacattcc agtgcccatc acttttggaa ccatgcctgc aacggcttgg
     801  tgttcccact ctgaagccgc agttttgcgt gccgccttga ctatcacgcg
     851  gctgaaactg atttctccac tcagccattc cacgtacggt acgtctataa
     901  tgacgtatct tctgccacta accgtccccg tacggtttct ccccgcaagt
     951  gcgtccattt ttcccagtaa atctaaactg ggcgttgagg tcccctctgg
    1001  tagggacctt cacactgcgt tcgtgagatc ttctcacgcg agcgctttct
    1051  tctctgacgc ggttcgcgct tcgtttgttc cgtccagcgc ggaacaattt
    1101  tttcaattcc gtcgtcagcg gacgcatgtt cttgctatta cagacccggt
    1151  cctgtgtggt acggtgtctg ttttaatgtc ggacggtgtt aacacagcac
    1201  gtctcgacgt tgttgctccg gcgtactatg cgtacgctga atctttgggc
    1251  gccagagtgc gctttttgtg ggagtctgcc gacgtggacg acgctaaagt
    1301  tcgtgacggt caatgttatg tccgtcatgt gttcgacgtg gctctctact
    1351  ttgggagacg cgccgacctt tccgtgcgta gagcgctggg tatgtacccc
    1401  acaggtggtg cactcccggc ttatcttgtt cgcgaatacg gtcgcgactc
    1451  tcttaaggtt cctatgcgtg ggacctacac ttttggcagt gtgtttcact
    1501  gcttgtcgct aaattttcaa gtcgaaatgc gatctattcc taaccatcat
    1551  ttagttggtg ggacgtctgc ccacgtctta attgggcagg ttcgagtcag
    1601  tgttcctggc tcgattgtta aaccttcacg ttcggccgtt cgtaggcgta
    1651  atagacgcat gcgacgtgat ggttttctcg gtagttccgg ttcttcttct
    1701  tctgcggggg agtcgactcg ctgttcggac tgctcttctc ctcgcggttt
    1751  acctgggcct tccgttttaa aaccttccct aggtcggatc ccgagtatag
    1801  atcggaagtt ccggtttcct gcgggtacgc agttgcgcgt ctccgtacct
    1851  aggcgggtcg atgaccatgt ttacgttttg actggtgcaa acttcgatga
    1901  gttgtgccat gcagttttga cacgtatgtc aaaaggtaca actctagaaa
    1951  tccttttaca ctcgattcga gagcggaagg gactacttgg ttttgcggcg
    2001  tgcttccgtt gggggttttc acacgtgttt gtaaagcgtg gcaactttac
    2051  tgcccgattt cctaaatcgg cggtcaggta tgagaatcag tatgccgcgg
    2101  ttatgatgga tgtggggacc agttgccttc cgaagggcta cgttcaagat
    2151  gttgatgttg tgaaacgtcg gagaagtcgt aatcgtcgtt ttcctctttc
    2201  ccatcgtgcg gtggatcagt cggtccccgc gttacagtcg agtcctgtcg
    2251  aggttgcttc ggtttcgagt gataagcctt catcgtcgca gaaggcttct
    2301  tcaccttcta cttcttcttc ttcttctttt aactcgacaa ggagttcaga
    2351  ctgggtgaat gtcggcctct ctcatcgaac tactaataag gttcgtgaac
    2401  cgcgttatgc tggtcatttt aggatcggaa attttacttt cccgaggggc
    2451  acagtgtaca acacgcctgt cgatgagcgc gcctataaac gtgttcttag
    2501  attgcgagat accacagcct gttcctaact ccgtatactg ctagctcgtt
    2551  tgtcgggtta cagaccttta agtgacgagt tctttaacaa gtgtgtacct
    2601  tcccggtttg tcgcgtgcat tgaacctgtg gaatcaggtc tcgttaaggt
    2651  gcatttccgt tctgatgttt tccgtgcctc tttcccgttt gacggtcaac
    2701  ctatacaccc cgccacggct ttgacagtag aagtggtggt ctcttgggat
    2751  tggatggtta cggcttttca gaatcccttg aaggatggat attgctacat
    2801  tcgccatttc gccgaagtta gtttgagcat ggggcgaatt ttcttcagga
    2851  gggacgtcga cttgggacct ttcccatacg ttttcgaagt gcaacaccgt
    2901  cttgaaaggt tgtacgggaa agctgacgta agatacggtg ttaggggtca
    2951  atattcagcc ccgcgctgtt ttcactgttg ctacaacgat tcaccgagac
    3001  cgatggcgtc ctttaatggg taccataaga tgggtggtga agataactcc
    3051  ctgataatca cagacaccga caggttgcat gctgtgggga gtgcctatga
    3101  aaaagtgaag agaaacatac cagattcgtt attggttcgg tctgtagaaa
    3151  aggaccttat agagtttaat cagactctag tcgacatgca tcgatccaga
    3201  ccgggcgttg tcgtaccttt ccaaatgagt gagaatcagc aagtgatgct
    3251  tactaccgcg tacccggaat ttaatattaa ttttattcat tccgtacatt
    3301  ccgatcatcc ggtggcagca ggttctaggg cgttggagaa tcatctcgtt
    3351  cgtaaacacg ctggtaccga ttattcggat gtggggggtt gtccgctgtt
    3401  tcatttacgt gcgggtcact ccggcgttca cgtttgtaga ccggtgtacg
    3451  atgttaaaga cgctcatcgt agagtagtcc gtcatcacca acttagtaag
    3501  gtttcgctag atcagagtga cggtgttaaa caagttggct ggaccgtaaa
    3551  cacgaattct gtatgcggta acattttggg agagtgttat catgcatcgg
    3601  aggcgatggt tatggttcaa gtttatgacg taccgctacg tgagttgtgt
    3651  agggctatga taaacaagaa aacttccgtg tgttatatga ccatggttac
    3701  acctggtgag ttgttggacg cccgcgagtc cttttttatt aaggacttgg
    3751  attgttcggt tgagttagat cccattgcag acagggttgt ttactgtttc
    3801  aacaattctg cgtatacaca cacgtactcc actatatgtg agtgtatgcg
    3851  aactccttgc ttggtagtgg acgggttttt gtttactatc gaaatggtat
    3901  cgctcaggtg tagcgttaat tactattgta tcaccaagtc gtcggtctgt
    3951  ccgagaatta gtgagactaa gcggttgcgc taccgtcggt gtgatagcga
    4001  cttgattaga atcaaaattc cccggtactc cagtaagact cgtaaccgtt
    4051  tacctgggtg ttactatttg tacttggacg ccaagtttgt aagtcgcgtg
    4101  tacgagtacg tggtcaataa ctgcgttgtg gtgaacgcga aaacttttga
    4151  gtggacttgg aattacatca aatcttgcaa gtcgagagtg gtgatcagcg
    4201  ggaagattat acaccgagac gaactaatcg ctttagagta cttagatggg
    4251  ttttctgcgg ttatgctgtc cgctggcgtg aagggtaggc aaaacgcgga
    4301  cgtttctaga cgcttagccg ctttttcggg tgaaacttcg atttacgagt
    4351  tagtggggtt tgctatatcc gagaagtgcc gcgacttgtt cttgggtatt
    4401  caggacgctg tggaaagatg cgtgaagtcg tacctcagga attcgtttaa
    4451  tatgagtttc gtggacttgt ccgacccctt acttacgatt agcgaatatt
    4501  cagaattgga cgttcctatc gacttgccgg gtttcggtgg aatagtggac
    4551  ggtaacgaaa ctagacttat ggaagacggt gttaaatcgg ctttattacg
    4601  taaagcggtt caagccgagg ctcagttgag tcttaagaga ggcaatactt
    4651  ccgaaatcgt tccgtgtgat gacgatgacg actcgaacgg tgatgtttcg
    4701  cgtgtttcgc tcgatacgga ctggtggttc gtccttcggg gtggtatttc
    4751  tggcgggttg cgagctggag ccgccccttc tttgtttagg tgtttactca
    4801  ggaaattggg tgggggttta tgtttggcaa agaaagtgtt ggaactgtta
    4851  gtcaagcggg tggttgaatc gttttctcgt ttgaagcgga aaaccgctcg
    4901  tttaacgtcc ttcgctaatt tgttgcttgc gaggctctct tgcgggtttt
    4951  tcgatgacac tgttttttct gcggtctggg aaatagcgat caacctgacc
    5001  aggatcgtcg atggagtagt caagacaaaa ctggggtgct ttcgtaattt
    5051  atttcgattg attcccaagt tatacgctgg ttgtaaggac gttgtgaagg
    5101  acgttagtaa cgcttacagg tcggttgtct cgttttccgc tgaggttttg
    5151  ggtaagagtt actctaaact ttgtcagttt tgcttggaaa tatttgacat
    5201  cgggcttatt gaggtttctg ctcgtaattt gggactggaa acatgcgttt
    5251  caatagcact agctattttt gatgtgttga ttacttttcc tttggggagc
    5301  gttagttttc ccgtcgtttg cgctagggtt ttcggtcgtc tcgctatgga
    5351  agtgggatcg aactttttgt ttaagaaagt tttcggtaaa cccgaaactc
    5401  ttggtgaaga tactttccgt aggactgtga gtatggtttt gaggcccaaa
    5451  gcgtttgaca agctttccgt ggatgcgaaa ggtttagtta ggtgctctgg
    5501  tgttattcct ggagtgttaa ggataatact atcttccttg ttttccgaag
    5551  atgacgcttg ggtgggttat agtaaacatg aagtttcttc ccttcctatt
    5601  gttacctttt gtgtgaagag attgtcttat tctctggagc ggtgtaagga
    5651  agcgtgtgtc gcatttattg ttgactctgc taagaagatt ttgaaatctt
    5701  taacttcaga gttcaacgaa tccattcaaa actccgactt gaccagtggt
    5751  gctaagtcct tgtacgggca cgtgagctcg atactttaca cctctagtgg
    5801  tgtgattaat aaagcaggaa gcgccgtcgc tactgttaaa gcggtcggga
    5851  gtgatatcag tggtcgtgtg aaacgtatgc gaccccgatt ttctctgtcc
    5901  cgtcactttg acgagcagac tagtgagtac tactctgcta gcgattgttc
    5951  cgaactagat gagtcgttgt ttagtgaaac gcctggtctt cgtggaaacg
    6001  ccaggtgtag agatttgttt cgtatcgtgt ctagacgcgc ggtagcgtgt
    6051  tgtgagtacg tgacaattct tttgaaacgg ctagcgtcgc gtgccggtga
    6101  atactcctac tcgtatgtga tggatacgct cgtgagattg tatgtggcga
    6151  ccgatgatgt tgttagacgg tgcaggtcct ttacgttcga ctgtactgat
    6201  aaagcatcta atttcgtcac cgggtttctt agttggcgca gcttacgttc
    6251  tggtgcgtac tctgcaactc cagggttggg tggtggtagt agaggtttaa
    6301  cgtcgttttc tcacaccggt ggattcacgc gcgttatcgg cgctcttggg
    6351  aacaccttat cggtggtgtt tgatgaggaa ttcttcagaa ctttgctgca
    6401  tcggttgagg gcagatgttg tggttttact ggtggagttc ttgaaaaacc
    6451  ttcccgtttg tttgttttca atatacactt ttattgaatg tcggggtagg
    6501  atctttcctt taagagagtt cctatggggt ttttgtcgtt tcgtttggga
    6551  tgttatcgag gggttgtcca tcaatactta tcaatacctc tctgctgtcg
    6601  ctgagaaagt gtatcgaggt gcctaaaatc gtcgatttaa cgaagaggat
    6651  gagaggacgc ttcgagtgat cacggaagca gagggaagaa tcgaattttt
    6701  gcgagttgtt ctcgcggaaa tggaaaggtt ccgtgctgcg tcgaacgagg
    6751  tttcttcgtc gaggtcgtct gatagtcctt cattcccacc tacttacggt
    6801  gaaattgagg agttagctga tgattcctcc gatagtgcgc tagtgatagg
    6851  cgtcgacaac ggtaccggcc gcactatcgt tgacggtgag accgattctg
    6901  cgtccggtag cgatagtgac gtttctatcc cgttggatcg cgattttgaa
    6951  caaatcgggc gtcttggcgg aaacgataac gtcgatgtcg ttcggctggg
    7001  tttgaaattc gttctgaagt tgttacgcaa cctattcgat gctagaagtt
    7051  ttaaagtgtt gtatgggttg ttacttcaaa ccctttttta tggtggttcg
    7101  gtaaataaat ttgtgtgtcg tctggtcttt agtcttggga cttgcttacc
    7151  tttcgagtta ctccgaattg cgtgttcagc gaggcggttg ttgaagagtt
    7201  tggcatcatt tgtttaccag actaaccttt tcagcgaagt tatggtggag
    7251  catttgttta gcgtttcccg actgctttat gattcccggt acttcgcgac
    7301  tgtgttttcg gaattggaga gacttaactt ctattttgac tatttccttt
    7351  cgctcccgaa gagatatcta ttccctaatt ctagggctcg tagttgtgct
    7401  agggttccgg ttcccgtgat taggaccgaa ggagtggcac cagtccgtga
    7451  gagatcacta aatgacatac tggactcttt agactcttta aaggtgtcgg
    7501  acctcaaagg gaaggcgacg ttcgttgatg atggggagtc ggattccggt
    7551  agtgaacatt cgggtagttc gatttcgttc ggttccgtca acgaagaagt
    7601  tttaaatgcg gtaaatggtg acagcgtttg cgaaaaagcc ccgttgatga
    7651  agcatgttac cgcacttagc aggttggaac gccaccctag tggtcgtaaa
    7701  gacattcctg tttctaggaa aacttttgtg cgtggtgaat cttcgggtgt
    7751  gaaatcgaag gtgagtatgt gcgattactt ggtgaccttg aattcttcgt
    7801  ttggcacagt gcctgacatg taccctgttg cgcgtgacat aacgtataag
    7851  aaactgacta acgccatgcg cgaattctat tactcgcaaa aaataacctt
    7901  gtacgaactt cacgggaagt tgagttccta ttgggacgag ttgaaggtcg
    7951  caggtttcga tagaaagtta acgagaatgg atttggacga tgatgtctat
    8001  gttgttgact ttaatcggaa attgttggtg gggagaaacg gatctcatcc
    8051  gttctgtaat acgttaaagt cctattgttt tatgttttgt aacgatgggt
    8101  tggttccttg cccgcgttct cagaaatatg attatgcttt gatttctaat
    8151  caaacgtctt ttgttgccgc gaattcgttc ttacgtgccg tggatggtaa
    8201  ggatttgact tttaccaatg aggaacatag ccttatcgtt tatgaagctc
    8251  ctccgaatgg tggtaagact cattctttgg tgaattcgta cgcggattat
    8301  tgcgttaaag tatcttgttt agtagtgacc gctaacaaga attctcaaac
    8351  cgagatatct cagcgcatat ctaatgaatt gatgggcagg aagctagctg
    8401  ctaagtatgt taccgatgca gcttccagag tgttcactgt agattcttac
    8451  ttaatgaatc acttgcgact tacgactcaa ctgctgttta tcgacgagtg
    8501  cttcatggtt catgctgggg caattggagc cgtggttgag ttcccgtctt
    8551  gtaaagcggt ggttttcttt ggtgatagta agcaaatcca ttacattcac
    8601  cgaaacgatc tcggggtttc ctttgttgca gatattgatg cgtttattca
    8651  accggaacat cgtatttacg gcgaagtgtc ctataggtgt ccttgggaca
    8701  tttgcgagtg gctttccgag ttttacccgc gacacgtagc tactgctaat
    8751  gtagggagta ttgggaagtc gagtgtgtca atagaggaaa tcaatgggtg
    8801  cgatgacgta ccttacgaca aggcggcaaa gtacattgtg tacactcagg
    8851  ctgaaaagaa cgatttgcaa aaacacctcg gtcgcttaac cgtgggtcgg
    8901  aacaaggtag taccaattgt aaataccgtt catgaggtac aaggagagac
    8951  ctatataagg gtacgtctgg tgaggtttaa gtatcaggag gataccccgt
    9001  tctcttcaaa gaatcatatt gtggttgctt tgactagaca tgttgattct
    9051  ttggtttatt ccgtacttac tagtaggagg tacgacgata ctgcgacgaa
    9101  catagatagg gcgaaggaaa tttttgacaa atttcgttcg tcgaatcact
    9151  cgtacggttc gtcatcgtta gagtggtacc ttgaaaagta tcctaccgaa
    9201  tataagggta gtaaagcatc ctctgctccg ataagttgca ttaacgaatt
    9251  tcttaatgag gtcgtcgttg gttcttctgt cgtgcagttg ggtgatgtgt
    9301  ctgaagaact aagttcacgt ccctttgaat cgggttgtga taatgttact
    9351  gtaagagaca ccgcccctcc tgactcgggt aacttattcg aaccggctcg
    9401  cgttcggcgt agtaaggtca caagcaattc ctccaagaaa agcgtcactg
    9451  caagaaaacc ttctgtcgta cgaaagtcgt aattataact ttatcaagac
    9501  ggaacggttt gttggaccaa gcgaatttgg tagggcgatg gctgctgctg
    9551  ttatcgaacg ttgtttcaaa atggaagaga tggctaagat aaggtgtgat
    9601  attatatcgg ttactgaagc taacatttta aaatggctcg ataagcgcac
    9651  tccctgtcaa ataaaggccg tacacgggga gttgaaactt cccttttcgg
    9701  tggaggagca aatttccaac ttcaaactga tggttaaacg tgatgctaag
    9751  gtaaaacttg acgattcaag tctatctaaa catcccgctg ctcagaacat
    9801  catgtttcat aagaagttta tcaatgccat attttccccg tgtttcgacg
    9851  agttcaaaaa tagagtgttc tcctcgctta atgacaatat cgtgttcttt
    9901  actgagatga cgaacgctgg gttagcggaa attatcagaa gaatcattgg
    9951  tgacgacgac aacttatttg ttggggaagt ggatttcagt aagttcgata
   10001  agtctcagga tttgttcatt aaagagtacg aacgtacgtt gtattccgag
   10051  tttgggttcg ataccgaact tctcgatgtg tggatggaag gtgagtatcg
   10101  cgctagagcc accacgctgg acggtcagct gagtttttca gttgatggtc
   10151  agcgtcgttc tggaggttca aacacttgga ttgggaattc cttggttact
   10201  ctaggtatcc tttcgttatc ttacgacgtt tcgaagtttg acttactcct
   10251  cgtttctgga gacgattctt taatttattc gagtgaaaag ataagcaact
   10301  tttcttccga aataagctta gaaacaggtt ttgagactaa gtttatgtct
   10351  ccgagcgtgc catatttttg ctcaaagttt gtggttcaga ccggtaacaa
   10401  aacgtgtttt gtgcctgacc cttataaatt attagtaaag ttgggggctc
   10451  cacaaaataa gttaaccgat gtcgagttat ttgagttgtt cacttctttt
   10501  aaggacatga cgcaggactt tggtgatcaa gtggttttgg agaagctgaa
   10551  gttgctagtc gaagctaagt acggtttcgc tagtgggacc actatgccag
   10601  cattgtgcgc tattcattgt gtgcgatcga actacttgtc ctttgagagg
   10651  ttatttcctt tcattagggg ttggtatgtt gttgacgctc taaaactcag
   10701  acagcttagg aaactcacta atttgatctg tgaacgtgta gtttccgata
   10751  atcgggtggg ttattaatcg tacttcgata acccgttcac taaacctgac
   10801  gctaacgacg ataacgtgga cgacctcgga caagcgggtg aattagcaac
   10851  cggctgatcg attgattagt tctcgctgag agctacagtg ggtagttgag
   10901  tcaggatgtt tgccttcgcg agcgaaagcc aagacttgtt agaagaaaaa
   10951  gtttttcgtc gtagaactta ccatcgtaaa tattttggtg acgtggttaa
   11001  ggacttcact atcggggttg gttatgatac taccgatcgc gatcctactg
   11051  tattggccga ttatttctca ttgtatttct ttttacttaa caacgatagt
   11101  gttgggccta tagcagcctc aattgaggta agcccaccgg ttagcgggac
   11151  tcataaaatt cgagcgcata tcgataatca accgaactgt gaaggtaacg
   11201  tgacttacgt taaaaccttc gacaaaagtc gctttgtgat tcgcgttaaa
   11251  gcgtccccgt ctatgagagg ttactactct tttcgggtgt ttctctgtag
   11301  cgatgtcgct agcgaacgca gcgagttcgt gtgcagtttt gttggtagca
   11351  ggtttctttg ctgttggaaa caaacgatat ctgaaaattt gagtaaagtt
   11401  tgttcatctt ccttcttctt cagagcagtt tcagaaaggg cgaccaacga
   11451  attttctgtt gcgactgatg atgtggaaga cgttaagtac ataagaaaac
   11501  aagccgaggg tttttcacgt tgcgctgacc catacgttcc taggtgttat
   11551  cgtagcacta atttgggcga ttcttcaggg gttcagagtc gtacgattga
   11601  agaggaaggt tatatgacgg gcactgcagg taacgtcgca gtcaccgtcc
   11651  cgaatactcc actagttagt gctgtacctc cgtatatcgc agggtacaac
   11701  gagaatgcac gctcgcgcgt ctcattaata cgccgggtct gttgttacgc
   11751  cgtttgcgtt ttagtggtgt ccgttcattt aatgagcggt ttattagcca
   11801  ttatatttat atgatttagt gtagtaactc ataaggtaca attacttact
   11851  taagactcgc cgtttgactc tgtttaaacg gggtttaatg gactgcgtaa
   11901  ttcaagggtt tttaactttc ctagttggta tagctgtgtt ttgtgccttt
   11951  gccggactga ttatctttgt tataacaatt tatcggtgca cgattaagcc
   12001  cgtcagaagt gcttcccctt acggcactca cgcgactgtc taagcggtat
   12051  ggtgcttttg ggtttagact tcggtaccac gttttcaaag gtggctatgg
   12101  ctacaccttc agagttagtt atactcaaac aatccaattc atcgtacata
   12151  cctacgtgtt tactcctgca tgcggaacct aacagcgtat cttatgctaa
   12201  cgatgcggaa tatttagcgg cttctgggga gtctggttcg ttttacaaag
   12251  atttgaagcg gtggattggt tgcactgcga agaactacca aacctactta
   12301  cacaaactat caccttccta taaggtgata gtgaaagagt ttggaactaa
   12351  gagcgtgccg gtgccatatt tgtcacctct gaataacgat ttaggcctca
   12401  gcgtcggttt accttcactg attgcttcgt atgccaaatc cattctgtcg
   12451  gatgcggaac gagtgttcaa tgtaagctgc actggagtta tatgttcggt
   12501  acctgctggt tataacacgt tacaacgagc ttttacacag cagagcatat
   12551  cgatgtcggg ttactcttgt gtgtacatta ttaacgaacc ttcagcagcc
   12601  gcgtactcca ctttacctaa gttgaattcg gcagataagt atttagccat
   12651  ttacgacttc ggcggtggga cttttgatgt ctctatagtt agcgttagat
   12701  tacccacttt cgccgttaga agttcgagcg gtgacatgaa tttaggcggt
   12751  agagatatcg acaaaaagtt atccgataaa atataccaaa tggctgattt
   12801  tgtgccgcaa aaagaattga acgtttctag tttaaaggaa gctttatctc
   12851  ttcaaaccga tccggtcaaa tatactgtga atcattacgg aatgagtgag
   12901  accgtatcaa ttgatctttc ggtgttgagg gagatagcct cggtgttcat
   12951  aaatcgaacg atagatatac ttacgaaagt taaggttaag tctagtatgc
   13001  ccgaatcgca aagtttgaag ttagtggtag tcggtggaag ctcgtaccta
   13051  ccagggttgt tggacgcttt ggcaaccgtg ccttttgtgt ctgggatagt
   13101  gccggtggaa gacgcaagaa ccgctgtcgc cacagggtgc gctttgtata
   13151  gcgagtgctt agatggtagg tctaaggccc tactaataga ttgtattacg
   13201  catcatttgt cggtcacgac gtttagcgcg gattcggtcg ttgttgcagc
   13251  ggccggtagt ccaattcctt ttgaaggtga acaaaaactc acgttacgca
   13301  aatgcgttag tacgtctaac tatcaagcaa gaatgttcga aggagattac
   13351  gaaaaagttt tccgaaatga acgtatatac gcagcttcga tatcattgtt
   13401  taccctagga gttaattgga gtgtgcctaa cgacgttgag atgactctcg
   13451  tgaccaaagt ggactcgatg ggtaaagtgg aattttacct taaaggtcca
   13501  tctggtgaac tggataacgt gcaaggtact tcgcattacg attatgctgg
   13551  tatgcctcac cccactagaa agctggtgag gcttagcgat tacaatgtaa
   13601  actccgccgc tttagtttta gctttgacat taactcgcga aaaacgagaa
   13651  aagttccttt tgcgaacatt atttgacact ttactagcga atttacgaaa
   13701  gacagcaagt ttaggcgagt actcaaagaa gtacccgatc actcgaaacg
   13751  atatcgatgt cgtctcatca cgtatgggga tcgttgtttc gaaagtttta
   13801  cggggaagcg atttggaaag aatacctctc tgaatcaact cgaaatttcg
   13851  atgaaagaaa tgtatcgtta gaccaagctt tgagttcggg tgtggtcgtc
   13901  cgtaggcaga gtcttttgaa tgcgcctcaa ggtactttcg agaacgggtt
   13951  agcgctattg tacaattcgg tggtgattaa cgattttgtt gagttgactg
   14001  gtatgccctt gaaatctttg atgacaggta tcgaagaccg taagcttcct
   14051  gacgaattaa tatccgttga cccgcacgaa gtcggatgta gattcacgtt
   14101  aaacgacgtg gaatcgtatc taatgagcag gggtgaagat ttcgctgatc
   14151  tagcggcggt cgagcattcg tggtgtttga gcaactcttg tggtagacta
   14201  ttaagttcga ctgagataga tgcttacaaa accttggtgt ttactaagaa
   14251  ttttgatagt aatgtatccg gagtgactac taagttagag acttatctat
   14301  cgtactgcat atcattgtac aagaaacatt gcatgaaaga cgatgattat
   14351  tttaatctta tcttacctat gtttaattgt ttaatgaaag tgctggcgtc
   14401  gcttggtttg ttttatgaga aacatgccga caatccgcta ctgaccggaa
   14451  tgctcataga gttttgccta gaaaataagg tgtattactc tacttttaaa
   14501  gtgaatttag acaacgtcag attgtttaag tctaaagtgt tgcctgtggt
   14551  gttaacggtt tgggatatat ccgagcctga tgacccaatg gatgaaaggg
   14601  tgctgattcc tttcgatcct acggatttcg tgctcgattt acctaaattg
   14651  aatatacacg atacaatggt ggtggtgggt aatcaaatca gacagttaga
   14701  atacgtagtc gaaagcgatg ctttagacga tctatctcaa cacgttgatt
   14751  tacgtttagc agcggacaat cccgatctac gcgttggtct gcgttgggca
   14801  gggatgtttg tgtactacgg tgtttatcgg tgtgttgttg atagagcggt
   14851  ggaacgaccg acgttgttta gattgccgca gaaactactg agtcaggatg
   14901  atggcgaatc gtgctcatta cacatgggtt ccgtcgaagc tttattcaat
   14951  ctggtgcaga aagtgaacaa ggacataaac gttagacgtc agttcatggg
   15001  acgtcatagt gaagtggctt tgcgactgta tcgcaactta ggtttgaggt
   15051  ttccaccgat ctcatcggtt aggttaccgg ctcatcacgg ttatttatac
   15101  gtcgattttt acaaaagagt acctgacggt gctgttaccg ccgacgaact
   15151  cgaaagttta cgtcaattac gctcatccgt ggacgttatg tgtaaggaca
   15201  gcctgtcaat cacacctcca ccattcaatc gacttagaag aggttcttct
   15251  agaacattta gaggtcgagg cgcacgcggt gcgagctcgc gtcatatgag
   15301  cagagacgtg gcgacttccg ggtttaattt accatttcat ggcaggttat
   15351  acagtacttc ctaaaaccga tgataaagaa atggatcctg tgagtgctgc
   15401  cgtgcccggt aagtatccgg atgtcattga aaagttcgtg gccaataggt
   15451  ccgtagatgc gttaatagaa ggcgttataa gtaaattgga taccccttca
   15501  atatacgaag attccactga aaagtttact ggtgaacact tgaaatacgt
   15551  tatggttact atggacactt tcttattaga aaactacaaa acgaaaacgg
   15601  aagatctgtt ggttcactta actatgatcc aaaagaggtt atacactata
   15651  tccacgagca ctaaaaccaa gtttcgcgat aaaggttgta ttagttacgt
   15701  acaagggggt ttacgatata agttgttgga caaagtagtt tttcctttca
   15751  ttatatcgaa atttaccgac agggagactc caaacgctct acgtaagttt
   15801  gcttgcactt tcgaggagtt acacttgtgt atggctaggt taagacccga
   15851  cttatacgaa aataaaagga cgaccagggc tgggactcca catttaaagg
   15901  gctacctatc agctgacttt ctctcaggtt ctctccctgg gtactccgaa
   15951  catgaacgag gtatcattct tcgagcgtcc gagtctatgt tagctagacg
   16001  tcaaggttac gaggaggcga ccgagcttct taacctacgc gatttgggta
   16051  agtacttata gttggtttgg ggacggtaac attatactat cccatgagcg
   16101  ctgccttaag ggtcgttaat tgacgacttt tgatatattt actaggtttg
   16151  aattatggac gacgaaacaa agaaattgaa gaacaaaaac aaggaaacaa
   16201  aagaaggcga cgatgttgtt gctgccgagt cttctttcag ttccgtaaac
   16251  ttacacatcg atccgacttt gataacgatg aacgatgtgc gtcagttgag
   16301  tacccaacag aacgctgctt tgaacagaga cttattcctt actttgaaag
   16351  ggaagcatcc taacttacct gataaagata aggactttcg catagctatg
   16401  atgttgtatc gtttagcagt taagagttca tcattacaaa gcgatgacga
   16451  cgccacgggt ataacgtaca ctcgggaggg tgttgaagtg gatttgtctg
   16501  acaaactttg gactgacgtc gtgtttaact ctaagggtat tggtaaccgt
   16551  actaacgccc ttcgagtttg gggtagaact aacgatgccc tttacttagc
   16601  tttttgcaga cagaatcgca atttgagtta tggcggacgt ccgctagacg
   16651  cagggattcc ggccgggtat cattacttgt gtgcggattt cttgactggg
   16701  gctggtttga ctgatttaga atgtgctgtg tacatacaag ctaaagaaca
   16751  attattgaag aagcgagggg ctgatgatgt cgtagttact aatgtcaggc
   16801  agcttgggaa attcaacaca cgttgatctg ttgcgttccg attcccggtt
   16851  tctatcggga tggtggagtt tcatcgtgaa cgtgggtgat ataatcgtcc
   16901  ggttcgcgtt acacgttcct aatgaagata tgctgaatag tttttcagct
   16951  atatcgaatt gtacgattat agcggacggt agtgctttac taaaagataa
   17001  tactgtggtc gatcgtttag aaggcatgaa tcctttggct tatttattaa
   17051  aattagcgaa aacgactact actatttgtt ttactatgtc taataaggtt
   17101  ctttttggta ctactaaatc cgaaccactt agttgtttag ctatcacgtc
   17151  ggatcgagtt ttattcaaag ttgttatggg tactaacgtt gacgattctc
   17201  gatgcggctg cagtatttgg ttttacaaca acggtacgtt tcaaaatgga
   17251  ttgatccgtt gtaataatct cgtcactttg tttagcgtga cttagacacg
   17301  aagtgactgt tcggattcaa ttgctgcaat gagcattcgg cgctcgtggt
   17351  taaaggttat ggctgtagtt acggtattat ggtacggtaa agagccttcc
   17401  attagtgaag gttacaatgc tctcatgaat gatgacttta agtttatcga
   17451  tacgcatttt acaaacgttt cttacgctaa gaaatgttac gatttggcta
   17501  atttcgattt agactttcta cgcatcgtta tcattccttt gagtgggggt
   17551  acggtgaatg aatcgcgtgc tgatcgcact aacgtttcag aaattgtcga
   17601  atcgcatgtg agcgaccgag acaggatgag catcttgttg cgtaataagc
   17651  ggatccaaat tccttcgctc ttaccttgcg ataactagag tctactcagt
   17701  agtacgtcta ttagtataac gtattaagca ctttagtaaa gggttttgtt
   17751  taaatcaaac aatatgcgag cttactttag tgttaatgat tacataagcc
   17801  ttttggctaa ggtcagcgct gttgtggaac gtttatgcga tcccagcgta
   17851  actcttgcgg aagtgatgga cgaaattaat gactttaact cgtttctcgc
   17901  tttagtgcac tctatgaagt cagacatgaa cggagaccat caggatggcc
   17951  accacgagat gggtgaacac aagtctcggt tgttatgcaa catagaggcg
   18001  aaattgcgag tacttctcga catcataaga cgtcggttca ctcgcgacaa
   18051  gctgctctgt actagcgcga cagatgtcat gggcttcttt gtaatgaggt
   18101  acatgagttc tagccacacc agcttcgaat ccgtaatgag gacggagttg
   18151  aggttggtgg ttaaggcggt actgtcggat ttatcccgcg cgcataaact
   18201  ggattttagc gagcgagctt ttgcggctta tggtatcctt ttgcaaaagg
   18251  gtactgtgtc gaccgtttgc ggtcagtttg acattaattt agtctctcca
   18301  tcttgcgtgt aggttaatac gcttctcaga acgtgtggtt gtattaacta
   18351  actttaattc gaacaaatat attgtgaaag tctgcgagtt acaatggata
   18401  atactagcgg acaaactttc gtttctgtga acctttctga cgaaagcaac
   18451  acagcgacca ctgacgtcga acccgtgagt tcggaagcgg atcgcttgga
   18501  ttttttacag aaaatgaatc ccattattat cgatgctttg atacggaaga
   18551  atagttatca gggcgctcgc tttcgcgcga gaataatagg agtgtgcgtg
   18601  gattgcggta gaaaacacga taaggggttg aagactgaac gtaagtgtaa
   18651  ggtcaacaat acgcagtctc agaacgaggt ggcgcatatg ttaatgcacg
   18701  accccgttaa gtatttaaac aaaagaaaag ctagagcctt ttctaatgcg
   18751  gagatatttg cgattgattt ggttatgtac accaaggaaa ggcaattggc
   18801  tattgatttg gccgctgaaa gggagaaaac gagactggct cgtagacacc
   18851  cgatgcgttc tccggaagaa actccggaat attataaatt cggtaggact
   18901  gctaaagcaa tgttaccgga catcaacgcc gtagacgttg gtgataacga
   18951  ggaaacttcg tcggagtatc cagtgagtct gagtgtttct ggcggagttc
   19001  tccgcgaaca ccacttcatc tgattgaagt ggacggaata agttcctcgc
   19051  ggaactttgt gttgggttgg taaagaccct tatgatggtg atatatcact
   19101  agacaataac cggatgggta aagtctttaa aatgatcgag gggaaaatta
   19151  accgtatcct ctcgttggtc taagctccca cagagtggta gtggtctcaa
   19201  gtgaggctta acgtatgcgt gaaccaaaga agttctcctt agagtgtgtg
   19251  ttgtttaccc aacgcactgt ccctatgggg ggccaacata ggtcca