Sequence of DPV Havel River virus

Havel river tombusvirus strain H coat protein gene, complete cds.

ACC No: AY370534

Dated: 2005-04-16 | Length: 1200 | CRC: -389375955

                !!NA_SEQUENCE 1.0
ID   AY370534   standard; genomic RNA; VRL; 1200 BP.
XX
AC   AY370534;
XX
SV   AY370534.1
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Havel river tombusvirus strain H coat protein gene, complete cds.
XX
KW   .
XX
OS   Havel river tombusvirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1200
RA   Koenig R.;
RT   "Isolation of two strains of a new tombusvirus (Havel river virus, HaRV)
RT   from surface waters in Germany";
RL   Eur. J. Plant Pathol. 0:0-0(2004).
XX
RN   [2]
RP   1-1200
RA   Koenig R.;
RT   ;
RL   Submitted (18-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und biologische Sicherheit,
RL   Biologische Bundesanstalt fur Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1200
FT                   /db_xref="taxon:254711"
FT                   /mol_type="genomic RNA"
FT                   /organism="Havel river tombusvirus"
FT                   /strain="H"
FT   CDS             19. .1161
FT                   /codon_start=1
FT                   /db_xref="GOA:Q67BT2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q67BT2"
FT                   /product="coat protein"
FT                   /protein_id="AAR26608.1"
FT                   /translation="MSIATRNSNRALARLAAPAAMAGARMIVENKEALWNGAKWIWANL
FT                   PKKKKGNKSNGGLISHPQTLPGAIAAPISYAYPVRGRKPKFQASKGSVRITHREYISVV
FT                   EGNTDGNFVVNNGSGASNDFSINPLNPFVFPWLVSIASNFDQYTFRSLKFEYIPLANTG
FT                   ASGRVALFFDKDSTDPGPDDRSALANYRHLSEISPWAIARLTAPTDNVKRFMADNTTAD
FT                   PKLINLGKVGWVTYASQFANLGDLFVEYTVDLYEAQPTAAILESLFRESTNGALMRVGL
FT                   PYFTLEVADGTSLVYQARVPGTYLVTVIFNNTTAGFAISISGGGIINSSFGVSSAGRTS
FT                   VTANVTITRNANLSITSLIGATNAQIFVAKANKDNAVAVV"
XX
SQ   Sequence 1200 BP; 334 A; 270 C; 292 G; 304 T; 0 other;

 AY370534  Length: 1200  April 19, 2005 08:51  Type: N  Check: 8215  ..

       1  aagcatacac aagcacacat gtctatcgca acaagaaata gcaatagagc
      51  tttagcaaga ttggctgcgc ctgccgctat ggcaggtgct cgcatgattg
     101  ttgagaacaa agaagcgtta tggaatggag ccaaatggat ttgggcaaac
     151  ttgcccaaaa agaagaaggg caataagagt aatggtggat tgatatcaca
     201  ccctcagacg ctccctggag ctatagctgc acctatctct tatgcctacc
     251  cagtcagggg acgcaaacct aagtttcaag cgtctaaggg gtcggtaagg
     301  attacccatc gtgagtacat tagtgtagtc gagggtaata ccgatggtaa
     351  tttcgtcgtt aacaatgggt caggggcaag taatgatttt agcatcaacc
     401  cgctcaatcc ctttgttttc ccatggttag tcagtattgc atccaacttt
     451  gatcagtaca catttcgcag tttaaaattc gaatatatcc ctcttgcgaa
     501  cacaggagcg tctggtagag tggcattatt ctttgataaa gatagcacag
     551  accctgggcc cgatgatcgg tctgctctgg cgaactatcg gcatcttagt
     601  gaaatctccc catgggcgat tgccaggctc acagcaccaa ccgataatgt
     651  taagaggttt atggccgata ataccactgc cgatccgaaa ttgataaatc
     701  ttggaaaagt tggatgggtg acgtacgcgt cccaattcgc taacctgggt
     751  gacttattcg tcgagtacac cgtagacctt tatgaagcgc agcctacagc
     801  agctatactg gagtctctct tccgggagag tacaaatgga gcgctgatgc
     851  gtgttggact accctacttc acccttgagg tagcggatgg cacatcacta
     901  gtataccagg cgcgcgtccc tggaacttac cttgttactg tgatcttcaa
     951  taataccact gctgggtttg caattagcat ctccggcgga ggaatcataa
    1001  atagttcatt cggggttagt tctgcgggta gaacgtccgt gacagcaaac
    1051  gtaaccataa caagaaatgc taatctcagc ataaccagcc tgattggagc
    1101  aactaatgcc caaatattcg tcgctaaggc gaataaggat aatgcggtgg
    1151  cagttgtgtg attttgaagg ggcctcttga atacgaccaa ttcatggata