Sequence of DPV Havel River virus

Havel river tombusvirus strain S coat protein and movement protein genes, complete cds; and unknown gene.

ACC No: AY370535

Dated: 2005-04-16 | Length: 2088 | CRC: -1448649477

                !!NA_SEQUENCE 1.0
ID   AY370535   standard; genomic RNA; VRL; 2088 BP.
XX
AC   AY370535;
XX
SV   AY370535.1
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Havel river tombusvirus strain S coat protein and movement protein genes,
DE   complete cds; and unknown gene.
XX
KW   .
XX
OS   Havel river tombusvirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-2088
RA   Koenig R.;
RT   "Isolation of two strains of a new tombusvirus (Havel river virus, HaRV)
RT   from surface waters in Germany";
RL   Eur. J. Plant Pathol. 0:0-0(2004).
XX
RN   [2]
RP   1-2088
RA   Koenig R.;
RT   ;
RL   Submitted (18-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und biologische Sicherheit,
RL   Biologische Bundesanstalt fur Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2088
FT                   /db_xref="taxon:254711"
FT                   /mol_type="genomic RNA"
FT                   /organism="Havel river tombusvirus"
FT                   /strain="S"
FT   CDS             19. .1161
FT                   /codon_start=1
FT                   /db_xref="GOA:Q67BT1"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q67BT1"
FT                   /product="coat protein"
FT                   /protein_id="AAR26609.1"
FT                   /translation="MSIVTRNSDRALARLAAPAAMAGARMIVENKEVLWNGAKWIWANL
FT                   PKRKKGNKSNGGLISHPQTLPGAIAAPISYAYPVRGRKPKFQASKGSVRITHREYISVI
FT                   EGNTDGNFVVNNGSGASNDFSINPLNPFVFPWLVSIASNFDQYTFRSLKFEYIPLANTG
FT                   ASGRVALFFDKDSTDPGPDDRSALANYRHLSEISPWAIARLTAPTDNVKRFMADNTTAD
FT                   PKLINLGKVGWVTYASQFANLGDLFVEYTVDLYEAQPTAATLESLFRESTNGALTRVGL
FT                   PYFTLEVADGTSLVYQARVPGTYLVTVIFNNTTAGFAISISGGGIINSSFGVSSAGRTS
FT                   VTANVTITRNANLSITSLIGATNAQIFVAKANKDNAVAVV"
FT   CDS             1192. .1761
FT                   /codon_start=1
FT                   /db_xref="GOA:Q67BT0"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q67BT0"
FT                   /product="movement protein"
FT                   /protein_id="AAR26610.1"
FT                   /translation="MDTEYGQVNKPWKELYKEATLGNKLTVNVGMEDVEVPLLPSNFLT
FT                   KVRVSMSGGYITVRRVRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTELLDLGKEV
FT                   RLTMQHLDFSVLARSDVPIVFGFEDLVSPYLEGRELYSVSLRWQFGLSAQCYSLPPAKW
FT                   KVMYQEDALKALKPSKRKASKTDSSV"
FT   CDS             1224. .1742
FT                   /codon_start=1
FT                   /db_xref="GOA:Q67BS9"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:Q67BS9"
FT                   /product="unknown"
FT                   /protein_id="AAR28057.1"
FT                   /translation="MEGAIQGSDAREQANSERWDGGCGGTITPFKLPDESPGLHEWRLH
FT                   NSEESEDKDHPLGFKESWGFGKVVFKRYLRYDGTEASLHRALGSWERGSVNDAASRFLG
FT                   LGQVGCTYSIRFRGSCLTLSGGSRTLQRLIEMAIRTKRTMLQLTPSEVEGNVSRGRPEG
FT                   AKAFEKESE"
XX
SQ   Sequence 2088 BP; 571 A; 444 C; 558 G; 515 T; 0 other;

 AY370535  Length: 2088  April 19, 2005 08:49  Type: N  Check: 7428  ..

       1  aagtatacac aagcacacat gtctatcgta acaagaaata gcgatagagc
      51  tctggcgaga ctggccgcgc ctgccgctat ggcaggtgcg cgcatgattg
     101  ttgagaataa agaggtgtta tggaatggag ccaaatggat ttgggcaaat
     151  ttgcccaagc ggaagaaagg taataagagt aatggtggat tgatatcaca
     201  cccgcagacg ctccctggag ctatagctgc accaatctct tatgcctacc
     251  cagtcagggg acgcaagcct aaatttcaag cgtctaaggg gtcggtaagg
     301  atcacccatc gtgagtacat tagtgtgatc gagggtaata ccgatggtaa
     351  tttcgtcgtt aacaatgggt caggggcaag taatgatttt agcatcaacc
     401  cgctcaaccc ctttgttttc ccgtggttag ttagcattgc atccaacttt
     451  gatcagtaca catttcgcag tttaaaattc gagtatattc ctctagcgaa
     501  cacaggagcg tctggtagag tggcattatt ctttgataaa gatagcacag
     551  accctgggcc cgatgatcgg tcggccctgg cgaactatcg gcatcttagt
     601  gaaatctccc cttgggcgat tgccaggctc acagcaccaa ccgataatgt
     651  taagaggttt atggccgata atacaactgc tgatccgaaa ttgataaatc
     701  tcggaaaagt tggatgggtg acgtatgcgt cccaattcgc taacctgggt
     751  gacttattcg tcgagtacac cgtagacctt tatgaagcgc agcctacagc
     801  agctacactg gagtctctct ttagggagag tacaaatggg gcgctgacgc
     851  gtgttgggtt accctacttc actcttgagg tagcggatgg cacatcacta
     901  gtttaccagg cacgtgtccc tgggacttac ctcgttactg tgatcttcaa
     951  taataccact gctgggtttg cgattagcat ctctggcgga ggaattataa
    1001  atagctcatt tggggttagt tccgcgggta gaacgtccgt tacagcaaac
    1051  gtaaccataa caagaaatgc taatctcagc ataaccagtc tgattggagc
    1101  aactaatgcc caaatattcg tcgccaaggc gaacaaggat aatgcggtgg
    1151  cagttgtgtg attgaagggg cttcttgaat acgaccaatt catggatact
    1201  gaatacggac aagtcaataa accatggaag gagctataca aggaagcgac
    1251  gctagggaac aagctaacag tgaacgttgg gatggaggat gtggaggtac
    1301  cattactccc ttcaaacttc ctgacgaaag tccgggtctc catgagtgga
    1351  ggctacataa cagtgaggag agtgaggata aagatcatcc ccttggtttc
    1401  aaggaaagct ggggtttcgg gaaagttgta tttaagagat atctcagata
    1451  cgacgggacg gaagcttcat tgcacagagc tcttggatct tgggaaagag
    1501  gttcggttaa cgatgcagca tctagatttc tcggtcttgg ccaggtcgga
    1551  tgtacctata gtattcggtt tcgaggatct tgtctcacct tatctggagg
    1601  gtcgcgaact ctacagcgtc tcattgagat ggcaattcgg actaagcgca
    1651  caatgttaca gcttaccccc agcgaagtgg aaggtaatgt atcaagagga
    1701  cgccctgaag gcgctaaagc cttcgaaaag gaaagcgagt aagacagact
    1751  cttcagtctg atactgccga agcgagtgaa tactgtttga gcatgcaggt
    1801  tactcttcgt attgttcggt ctacataatg acgagtcagg tcaggctccg
    1851  cactaggttc ggtcacctag gggatggaga catggaaggg atctcgtgcg
    1901  ctataagtct aacgaaagtt gagcttgcga catgggtcta tgcctggata
    1951  agttgtgtag gttgccgcat acgatgaatt ggatgcctgt ttacgactaa
    2001  tagggaacac tagtggaaac agtaaaggac acggttcatc tcacccttcg
    2051  ggggggctat agagatcgct ggaagcacta ccggacaa