Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 strain Alfie membrane associated protein P6 (P6) and Hsp70-like protein genes, complete cds.

ACC No: AY456132

Dated: 2003-12-03 | Length: 2466 | CRC: 409420209

                !!NA_SEQUENCE 1.0
ID   AY456132   standard; genomic RNA; VRL; 2466 BP.
XX
AC   AY456132;
XX
SV   AY456132.1
XX
DT   30-NOV-2003 (Rel. 78, Created)
DT   03-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 strain Alfie membrane associated
DE   protein P6 (P6) and Hsp70-like protein genes, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-2466
RA   Bonfiglioli R., Edwards F., Pantaleo A.;
RT   "Graft incompatibility syndrome in New Zealand Merlot vines involves
RT   another possible variant of GLRaV-2";
RL   Aust. N.Z. Grapegrow. Winemak. 476:50-54(2003).
XX
RN   [2]
RP   1-2466
RA   Bonfiglioli R., Edwards F., Pantaleo A.;
RT   ;
RL   Submitted (01-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL   Linnaeus Laboratory, Riversun Nursery Ltd, Lowe Street, Gisborne 3801, New
RL   Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2466
FT                   /db_xref="taxon:64003"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cultivar Merlot"
FT                   /strain="Alfie"
FT   gene            211. .381
FT                   /gene="P6"
FT   CDS             211. .381
FT                   /codon_start=1
FT                   /gene="P6"
FT                   /product="membrane associated protein P6"
FT                   /protein_id="AAR21243.1"
FT                   /translation="MDQVLQFECLYLLNQAVFAITFVFIXLIIRVIKSFRRSAHEVSNT
FT                   TVRSGGFSTVV"
FT   CDS             392. .2191
FT                   /codon_start=1
FT                   /note="capsid protein"
FT                   /product="Hsp70-like protein"
FT                   /protein_id="AAR21242.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGKVYSYKQNNSAYIPTYLYLFSETN
FT                   NMVFGYEAESLMHNAKVKGSFFRDLKRWVGCGSSNFGEYFDRLKPHYSVRLLKIGSGLN
FT                   DTVALGNYGGTVRSEVHLPGLIASFIKAIISCAEDAFACACTGVICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMVNEPSAAALSACNLINKKSANLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRAFLNHLFSLTSLEPDLSLDISNLKESLSKTDAEIVYTLKGA
FT                   DDKREDVRVNKSILTAVMLPYVNRTLKILESTLKSYAKNMGGMRNVKCDLVLIGGSSYL
FT                   PGLEDILSKHRQVDRILKVSDPRAAVAVGCALYSSCLSGSQGLLLIDCAAHSISIADMS
FT                   CHQIICAPAGAPIPFSGTTPLYLARANKNSQRQIAVFEGEYIKCPKNRKICGSNIKFCD
FT                   IGVTSISYAPITFYLDVSISSVGAISFVVRGPEGKEVSLTGTPAYNFSSVILGTRSVRE
FT                   LHISLSNKVHLGLLLHRKADRRLLFTESETIRYVETVEVADVLKEFKSYSASSLPLDED
FT                   VEPLMGKSVQKILRGGRLEEIPI"
XX
SQ   Sequence 2466 BP; 642 A; 510 C; 602 G; 705 T; 7 other;

AY456132  Length: 2466  December 9, 2003 08:59  Type: N  Check: 3149  ..

       1  ttggatggcn agggtttttt acacttctgt taagaaagcg ctctttaaaa
      51  gcgggtgttc gctctacgag agttacatta ctccgttcgg ccaggcagtc
     101  atggtgtggg aagatgagta gcgctttttt cggcgttgtt atccattgtt
     151  atccacagct gtggtgcaat cgcatgacgt acacattgtg tgtcatcgtg
     201  taaatatctt atggaccagg ttttacagtt tgagtgtttg tacttgctca
     251  accaagctgt ttttgctata actttcgtct ttatcttnct gatcattcgc
     301  gtgatcaaat cttttcgcag aagcgcacac gaggtttcga acacgaccgt
     351  ccgtagtgga ggtttctcaa ccgttgtgtg atctttacga aatggttgtt
     401  ttcggtttag acttcggcac gactttttca acggtctgcg tgtacaagga
     451  tggtaaagtt tactcatata agcaaaataa ctccgcgtat attccgactt
     501  acctctacct gttctctgaa accaacaaca tggttttcgg ttatgaagcc
     551  gaatcactga tgcacaacgc gaaagtaaaa ggctcgttct ttagggactt
     601  aaaacgttgg gtgggttgcg gttcaagtaa ctttggagaa tacttcgatc
     651  gcttgaaacc gcactactcc gttcgtctgc taaaaatagg ttctggcttg
     701  aatgatacag ttgctctcgg aaattacgga ggtaccgtcc ggtctgaagt
     751  gcacttgccg gggttgatag cctcgtttat taaagcgatt attagttgcg
     801  ccgaagacgc tttcgcttgt gcgtgtacgg gcgtgatatg ttcggtgcct
     851  gccaattacg atagcgtgca aaggaatttc accgaccaat gtgtttcttt
     901  gagtggttat caatgcgtgt atatggtcaa cgaaccatca gcagcagctt
     951  tatcagcttg caatttaatc aataagaaat cagcgaatct ggcggtatac
    1001  gattttggtg gtggaacttt tgacgtgtcc atcatttctt accgcaacaa
    1051  cacgtttgtg gtgcgcgctt ccgggggaga cctgaatctg ggcggaagag
    1101  atgtggacag agctttttta aaccaccttt tttctcttac ttcattagaa
    1151  cccgatctat cgttagacat ttcgaatcta aaagagtcgc tatcgaaaac
    1201  tgatgcggag atcgtctaca ctttaaaagg ggctgatgat aaaagggagg
    1251  atgttagggt gaacaaaagt attcttacgg cagttatgct cccttacgtg
    1301  aatagaactc taaaaatctt agaatctact ttaaagtcgt acgcgaaaaa
    1351  catgggtggg atgcgcaatg ttaagtgcga tttagtactg attggggggt
    1401  cttcttatct tcccggtctg gaggacatcc tgtcgaaaca ccgacaagtt
    1451  gatcgaatac taaaagtttc cgaccctcga gcagcagtcg cggtcggttg
    1501  tgcgctgtac tcatcgtgcc tctcgggttc acagggattg ttactgatcg
    1551  attgcgcagc tcacagtatc tcgatagcgg acatgagctg tcaccagatc
    1601  atttgcgctc cggccggagc tcctattccg ttctcgggta ctacacctct
    1651  atacttagct agagctaaca agaactcgca acgtcaaatt gcagtgttcg
    1701  agggtgaata tataaaatgt cccaaaaaca gaaaaatctg tgggtcgaac
    1751  ataaaattct gcgacattgg cgtgacgagc atctcgtacg cgcctatcac
    1801  cttctatctg gatgtttcga tctctagtgt gggcgccatt tcatttgtgg
    1851  tnagaggccc cgaaggaaaa gaagtttcct tgacgggtac tcccgcttac
    1901  aatttctctt ctgtgattct cggaacacgt agtgttcgag agctacatat
    1951  tagtttaagc aataaagttc atctcggcct actgttacac cgaaaagcgg
    2001  atcgtcggtt attgtttacc gaaagtgaga caattcgtta cgtcgaaaca
    2051  gtggaagtgg cggatgtgct gaaggagttc aaaagttact cggctagctc
    2101  tctaccgttg gatgaagatg tcgaaccact catgggaaag tctgttcaaa
    2151  aaattttacg gggaggcaga ttggaagaaa tacctatcta aaagtattgc
    2201  cgcacactcc gcggacgtga aaaatctacc agatactcaa ttgtacggag
    2251  gtagaattgt aaagaagtcc gattttgagt ctgcagctcc gaaatcattc
    2301  gagcaggaat tgggattatt catactaagc gagcgagatg tggggtgggg
    2351  caagatgtgt ggaatgactg tggaagaggc agcgtaccaa ctcacgaacc
    2401  ccaatgcttt tcctatcgta gctgaaaaat ntgatccgga tnaaagantn
    2451  aaggccaaaa aactcg