Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate M1S CP25 gene, partial cds.

ACC No: AY490207

Dated: 2006-06-22 | Length: 627 | CRC: 1217279038

                
ID   AY490207; SV 1; linear; genomic RNA; STD; VRL; 627 BP.
XX
AC   AY490207;
XX
DT   29-DEC-2003 (Rel. 78, Created)
DT   22-JUN-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate M1S CP25 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-627
RA   Barzegar A., Hashemi Sohi H., Rahimian H.;
RT   "Characterization of Citrus tristeza virus isolates in northern Iran";
RL   J. Gen. Plant Pathol. 72(1):46-51(2006).
XX
RN   [2]
RP   1-627
RA   Barzegar A., Hashemi Sohi H., Rahimiam H.;
RT   ;
RL   Submitted (30-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL   Plant Molecular Biology, NRCGEB, Qhods Street, Tehran 14155-6343, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .627
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="M1S"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>627
FT                   /codon_start=1
FT                   /product="CP25"
FT                   /db_xref="GOA:Q6RVA6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RVA6"
FT                   /protein_id="AAR84295.1"
FT                   /translation="RRGDDVVAAESSFGSLNLHIDPTLIAMNDVRQLGTQQNAALNRDL
FT                   FLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGITYTREGVEVDLSDKLW
FT                   TDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRPLDAGIPAGYHYLCAD
FT                   FLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNTTL"
XX
SQ   Sequence 627 BP; 165 A; 121 C; 165 G; 176 T; 0 other;

ay490207 Length: 627  22-JUN-2006  Type: N  Check: 5548  ..

       1  cgaagaggcg acgatgttgt tgcagcggag tcttctttcg gttccttaaa
      51  cttacacatc gatccgactc tgatagcgat gaacgatgtg cgtcagttag
     101  gtacccaaca gaacgccgct ttgaacagag atttgttcct tactttgaaa
     151  gggaagtatc ctaatttgtc tgataaagat aaagactttc acatagctat
     201  gatgttgtat cgtttagcgg ttaagagttc atcattgcaa agtgatgacg
     251  acaccacggg cataacgtac actcgggagg gcgtcgaagt ggatttgtct
     301  gacaaacttt ggactgacgt cgtgtttaat tctaagggta tcggtaaccg
     351  cactaacgcc cttcgagtct ggggtagaag taacgatgcc ctttatttag
     401  cgttttgtag acagaatcgc aatttgagtt atggcggacg tccgctagat
     451  gcagggattc cagccgggta tcattacctg tgtgcagatt tcttgaccgg
     501  agctggcttg actgatttgg aatgtgctgt gtacatacaa gctaaagaac
     551  aattgttgaa gaagcgaggg gctgatgaag tcgtagttac taatgtcagg
     601  cagcttggga aattcaacac cacgttg