Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate M1 CP25 gene, partial cds.

ACC No: AY490208

Dated: 2006-06-22 | Length: 627 | CRC: -1537946018

                
ID   AY490208; SV 1; linear; genomic RNA; STD; VRL; 627 BP.
XX
AC   AY490208;
XX
DT   29-DEC-2003 (Rel. 78, Created)
DT   22-JUN-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate M1 CP25 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-627
RA   Barzegar A., Hashemi Sohi H., Rahimian H.;
RT   "Characterization of Citrus tristeza virus isolates in northern Iran";
RL   J. Gen. Plant Pathol. 72(1):46-51(2006).
XX
RN   [2]
RP   1-627
RA   Barzegar A., Hashemi Sohi H., Rahimiam H.;
RT   ;
RL   Submitted (30-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL   Plant Molecular Biology, NRCGEB, Qhods Street, Tehran 14155-6343, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .627
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="M1"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>627
FT                   /codon_start=1
FT                   /product="CP25"
FT                   /db_xref="GOA:Q6RVA5"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RVA5"
FT                   /protein_id="AAR84296.1"
FT                   /translation="ERRGDDVVAAESSFGSLNLHIDPTLIAMNDVRQLGTQQNAALNRD
FT                   LFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGITYTREGVEVDLSDKL
FT                   WTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRPLDAGIPAGYHYLCA
FT                   DFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNTR"
XX
SQ   Sequence 627 BP; 167 A; 120 C; 165 G; 175 T; 0 other;

ay490208 Length: 627  22-JUN-2006  Type: N  Check: 5468  ..

       1  gaacgaagag gcgacgatgt tgttgcagcg gagtcttctt tcggttcctt
      51  aaacttacac atcgatccga ctctgatagc gatgaacgat gtgcgtcagt
     101  taggtaccca acagaacgcc gctttgaaca gagatttgtt ccttactttg
     151  aaagggaagt atcctaattt gtctgataaa gataaagact ttcacatagc
     201  tatgatgttg tatcgtttag cggttaagag ttcatcattg caaagtgatg
     251  acgacaccac gggcataacg tacactcggg agggcgtcga agtggatttg
     301  tctgacaaac tttggactga cgtcgtgttt aattctaagg gtatcggtaa
     351  ccgcactaac gcccttcgag tctggggtag aagtaacgat gccctttatt
     401  tagcgttttg tagacagaat cgcaatttga gttatggcgg acgtccgcta
     451  gatgcaggga ttccagccgg gtatcattac ctgtgtgcag atttcttgac
     501  cggagctggc ttgactgatt tggaatgtgc tgtgtacata caagctaaag
     551  aacaattgtt gaagaagcga ggggctgatg aagtcgtagt tactaatgtc
     601  aggcagcttg ggaaattcaa cacacgt