Sequence of DPV Grapevine Algerian latent virus

Grapevine Algerian latent virus isolate WaterDoss coat protein gene, complete cds.

ACC No: AY500878

Dated: 2005-02-14 | Length: 1190 | CRC: -297001055

                !!NA_SEQUENCE 1.0
ID   AY500878   standard; genomic RNA; VRL; 1190 BP.
XX
AC   AY500878;
XX
SV   AY500878.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 3)
XX
DE   Grapevine Algerian latent virus isolate WaterDoss coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine Algerian latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1190
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1190
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1190
FT                   /db_xref="taxon:208084"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine Algerian latent virus"
FT                   /isolate="WaterDoss"
FT   CDS             11. .1141
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IT0"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/TrEMBL:Q64IT0"
FT                   /product="coat protein"
FT                   /protein_id="AAT00600.2"
FT                   /translation="MALALNTRKSNNGKVMEMLAYKAAAAGAELTLANVGNITRGVAQL
FT                   GKSVLGKKKRNRNVSQVGTLGGAVVAPVAVTRQIRGSKPKFSGRGTGSITVTHREYLGQ
FT                   VVTTADLQVNGGIVGNLLKVNPLNGILFSWLPTIAAGYDQYAFNRLSLQYVPLCATTAT
FT                   GRVAMYWDKDSTDLEPTDRVELANQAILKETSPWAEANLTIPTDRIKRFCDDSAVADRK
FT                   LVDLGQLGVATYGGTAVVAGDVFVSYTVTFYNPQPLATLMDTTRINTSNAVVTNVGPQY
FT                   TRIDIVSGNQWLITFRGVGKFVIFGSIRGTGAVVLALNGVIVNSSTTLTTPTGAMYVAN
FT                   VTVSSLPASVSYTMTTVTAGLHSAVRATRANDMGTP"
XX
SQ   Sequence 1190 BP; 313 A; 270 C; 318 G; 289 T; 0 other;

AY500878  Length: 1190  February 22, 2005 08:35  Type: N  Check: 5363  ..

       1  aaagttcaca atggcattag cactaaatac aagaaagagc aataacggta
      51  aagtgatgga gatgttagca tacaaagcgg ccgcggctgg tgctgagttg
     101  actctcgcca acgttggcaa cataacccgt ggtgtggcac aattgggtaa
     151  gagtgtgttg ggaaagaaga agaggaatag gaacgtatcc caagtgggta
     201  cattaggtgg ggcagttgta gcccccgtgg cggttaccag acaaatacgc
     251  gggtctaaac ccaaattttc cggcagggga actggtagca ttactgttac
     301  gcatagagag tacttgggcc aggtagtcac gacggctgac ctacaagtga
     351  acggaggcat tgtgggcaac ctcttgaagg tgaatccatt aaatgggata
     401  ctcttctcgt ggttgccaac cattgcagcc ggatatgacc agtatgcctt
     451  taacaggctt tcgctgcagt atgtaccgtt gtgtgcaact acagctaccg
     501  gtcgtgtagc gatgtattgg gataaggatt ctacggacct tgaacccact
     551  gatcgagtcg aactggccaa tcaagcaatc ttgaaagaga cgtcgccatg
     601  ggcagaagca aatttaacta tacctactga ccgcatcaag agattctgcg
     651  atgatagtgc ggtcgcagac cgcaaacttg ttgatctcgg acaacttgga
     701  gtggctacat atggggggac ggcggtggtt gccggggatg tgtttgtcag
     751  ttacactgtc acattttata atccacagcc gctggccacc cttatggaca
     801  ccacgcgtat taacacctcg aacgccgtag tcactaatgt gggaccgcag
     851  tatacacgga ttgatatagt gtcaggcaat caatggctga tcacctttcg
     901  gggtgtcggc aagtttgtca tatttggtag tatacgtggc actggggctg
     951  tcgtcttggc cctaaatgga gttatcgtta actcttccac cacccttacc
    1001  acacctacgg gagcaatgta tgtagccaac gtaaccgtat catcattacc
    1051  ggcaagcgta tcatacacca tgaccactgt cacggctgga cttcattcag
    1101  ctgttcgtgc gacacgggca aatgacatgg gtacacctta gtgcatgcca
    1151  ttttttaagg ggcttcttga acaagaccag ttcatgggta