Sequence of DPV Carnation Italian ringspot virus

Carnation Italian ringspot virus isolate Gyp 1 coat protein gene, complete cds.

ACC No: AY500879

Dated: 2005-04-16 | Length: 1211 | CRC: 416932411

                !!NA_SEQUENCE 1.0
ID   AY500879   standard; genomic RNA; VRL; 1211 BP.
XX
AC   AY500879;
XX
SV   AY500879.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Carnation Italian ringspot virus isolate Gyp 1 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Carnation Italian ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1211
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1211
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1211
FT                   /db_xref="taxon:39443"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation Italian ringspot virus"
FT                   /isolate="Gyp 1"
FT   CDS             10. .1170
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS9"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q64IS9"
FT                   /product="coat protein"
FT                   /protein_id="AAT00601.1"
FT                   /translation="MTMVLRNPGTMVPQGGNKMSKMAKNAFQQGLQAGAAYLVSNPKGA
FT                   LKKGKDAWNYMTAGGVPSGIVHSGGMKGAIMAPVAVTRQLRGSKPKFSGRTSGSVTVSH
FT                   RELITQVNNSTQFVVNGGVTGNLRQVNPLNGTLFSWLPSIAANFDQYTFNSVTLHYVPL
FT                   CATTETGRVAMYFDKDSEDLEPADRVELANYATLKETAPWAEAMLRIPTDRIKRYNDDS
FT                   SVNDRKLIDLGQIGIATYGGSGTNPVGDVFISYSVTLHFPQPTAAGVQTRRLDLTSVLD
FT                   TNVGPSYTITSSTATVYTVAFRTVGTFMLFGAVRSTGSPVIGLSSANIAINSNTTLNTA
FT                   GTAFSYMTNVTVSALPASITFTVVGVITSSTSHAVRASRTNNADLI"
XX
SQ   Sequence 1211 BP; 340 A; 268 C; 302 G; 301 T; 0 other;

 AY500879  Length: 1211  April 19, 2005 08:50  Type: N  Check: 225  ..

       1  aagcaagaca tgacaatggt actaagaaat ccaggcacaa tggtgcctca
      51  aggcggcaac aaaatgagta agatggcgaa gaatgcattt caacaaggat
     101  tacaagcggg ggcagcttat ttagtgagca accccaaggg ggcattaaag
     151  aaagggaaag acgcatggaa ttacatgaca gcagggggtg tgccaagtgg
     201  tatagtacac tcagggggaa tgaaaggcgc gataatggcg cccgtggcag
     251  ttaccagaca gttaaggggg agtaaaccta aattctccgg aagaacatct
     301  ggttccgtga cagtgagtca tagagagcta attacgcaag tgaacaactc
     351  aacgcagttt gtggttaatg gtggtgttac tggtaacctt aggcaagtta
     401  atcccttgaa tgggaccttg ttctcatggc tgcctagcat tgccgctaac
     451  tttgatcagt acacatttaa tagtgttacg ttgcattacg tacctttatg
     501  tgctactacc gaaactgggc gggttgcaat gtattttgac aaagattccg
     551  aggacctcga gcccgcggac agagtagagc ttgctaatta tgctacattg
     601  aaagaaactg caccatgggc cgaggctatg ttacgtatac ctactgatcg
     651  catcaaacgg tataacgatg acagcagcgt aaatgatcgc aaattgattg
     701  acctgggaca gataggtatt gcaacatatg gtggttcggg cacaaaccct
     751  gtcggggacg tgttcatatc ttacagtgtt actctacact tcccacaacc
     801  tactgcagcc ggtgtgcaga cacggcgtct tgatctcaca agtgttttag
     851  acacaaatgt cggacctagt tacactatca cgtccagtac ggctacggta
     901  tacacggttg ctttccgcac cgtgggtacc tttatgctgt ttggcgccgt
     951  gaggtctact gggtcacccg ttatcggact gtctagtgca aatattgcta
    1001  ttaatagcaa caccacattg aacacagccg gtactgcttt ctcctacatg
    1051  acgaatgtca cagtgtcggc tttaccggcg tctatcacat tcactgtagt
    1101  tggagtaatt acttcgtcaa cttcacatgc cgtgagagca tcccgtacta
    1151  ataacgcaga cctgatatag taccattgag gggcctcttg aacaagacca
    1201  gttcatggat a