Sequence of DPV Grapevine Algerian latent virus

Grapevine Algerian latent virus isolate Gyp 2 coat protein gene, complete cds.

ACC No: AY500880

Dated: 2005-07-01 | Length: 1193 | CRC: 548138584

                !!NA_SEQUENCE 1.0
ID   AY500880   standard; genomic RNA; VRL; 1193 BP.
XX
AC   AY500880;
XX
SV   AY500880.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   01-JUL-2005 (Rel. 84, Last updated, Version 4)
XX
DE   Grapevine Algerian latent virus isolate Gyp 2 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Grapevine Algerian latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1193
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1193
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1193
FT                   /db_xref="taxon:208084"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine Algerian latent virus"
FT                   /isolate="Gyp 2"
FT   CDS             13. .1143
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS8"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q64IS8"
FT                   /product="coat protein"
FT                   /protein_id="AAT00602.2"
FT                   /translation="MALALNTRRNNNGKVMEMLAYKAATAGAELALANVGSITRGVAQL
FT                   GKSMMGKKKRNKNVSQVGALGGAVVAPVAVTRQIRGSKPRFSGRGTGSITVTHREYLGQ
FT                   VVTTADLQVNGGITGNLLKVNPLNGILFSWLPTIAAGYDQYAFNRLSLQYVPLCATTAT
FT                   GRVAMYWDKDSTDLEPTDRVELANQVILKETSPWAEANLTIPTDRIKRFCDDSAVADRK
FT                   LVDLGQLGVATYGGTAVVAGDVFVSYTVTFYNPQPLTTLMDTTRINTSNAVITNVGPQY
FT                   TRIDVVSGNQWLITFRGVGKFVIFGSIRGTGAVVLALSGVIVNSSTTLTTPTGAMYVAN
FT                   VTVSSLPASVSYTMTTVTAGLHSAVRATRANDMGTP"
XX
SQ   Sequence 1193 BP; 330 A; 272 C; 310 G; 281 T; 0 other;

  AY500880  Length: 1193  July 5, 2005 08:55  Type: N  Check: 3496  ..

       1  aaatatacac aaatggcatt agcactaaat acaagacgga acaataacgg
      51  taaagtgatg gaaatgttag catacaaagc ggccacggcc ggcgctgagt
     101  tggctcttgc caacgtcggt agcataaccc gtggtgtggc acaattgggt
     151  aaaagtatga tgggaaagaa gaagaggaat aagaacgtat cccaagtggg
     201  tgcattaggt ggggcagttg tagcccctgt ggcggttacc agacaaatac
     251  gtgggtctaa gcccaggttt tccggcaggg gaactggtag catcactgtt
     301  acgcatagag aatacttggg ccaggtagtc acgacggctg acctacaagt
     351  gaacggaggc attactggca acctactgaa ggtaaatcca ttgaatggga
     401  tactcttctc ctggttacca actattgcag ccggttatga ccagtacgcc
     451  ttcaacaggc tatcattgca gtatgtaccc ttgtgtgcaa ctacagcgac
     501  tggtcgtgta gcgatgtatt gggataagga ttctacggat ctggaaccca
     551  ctgatcgagt cgaactggcc aatcaagtaa tcttgaaaga aacgtcgcca
     601  tgggcagaag caaacttaac tatacctact gatcgcatca agagattctg
     651  cgatgatagt gcggtcgcag accgcaaact tgttgatctc ggacaacttg
     701  gagtggctac atatgggggg acagcggtgg ttgccgggga tgtgtttgtc
     751  agttacactg tcacattcta taatccacag cctctgacca ccctcatgga
     801  caccacgcgt atcaacacct caaatgccgt aattactaat gtggggccac
     851  agtacacacg gatcgatgta gtgtcaggca accaatggct gataaccttt
     901  cggggtgtcg gcaagtttgt catattcggt agtatacgtg gcactggggc
     951  tgtcgtttta gccctaagtg gagttatcgt taactcctcc actaccctta
    1001  ccacacccac gggagcaatg tatgtggcta acgtgactgt atcatcatta
    1051  ccggcaagcg tatcatacac tatgaccact gtcacagctg gattacattc
    1101  agctgtccgt gcgacaaggg caaatgatat gggcacacct tagtgcatgc
    1151  catgcaagaa aggggcttct tgaacaagac cagttcatgg ata