Sequence of DPV Petunia asteroid mosaic virus

Petunia asteroid mosaic virus isolate Lim 1 coat protein gene, complete cds.

ACC No: AY500881

Dated: 2005-02-14 | Length: 1238 | CRC: -405155434

                !!NA_SEQUENCE 1.0
ID   AY500881   standard; genomic RNA; VRL; 1238 BP.
XX
AC   AY500881;
XX
SV   AY500881.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Petunia asteroid mosaic virus isolate Lim 1 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Petunia asteroid mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1238
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1238
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1238
FT                   /db_xref="taxon:270255"
FT                   /mol_type="genomic RNA"
FT                   /organism="Petunia asteroid mosaic virus"
FT                   /isolate="Lim 1"
FT   CDS             28. .1194
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS7"
FT                   /db_xref="UniProt/TrEMBL:Q64IS7"
FT                   /product="coat protein"
FT                   /protein_id="AAT00603.1"
FT                   /translation="MAMVRRNNNTGMIPVSTKQLLALGAAAGATALQGFVKNNGMAFVE
FT                   GAVDLTKRAYKAVRRRGGKKQQMINHVGGTGGAIMAPVAVTRQLVGSKPKFTGRTSGSV
FT                   TVTHREYLSQVNNSTGFQVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYTFNSVVLH
FT                   YVPLCSTTEVGRVAIYFDKDSEDPEPADRVELANYSVLKETAPWAEAMLRVPTDKVKRF
FT                   CDDSSTSDHKLIDLGQLGIATYGGAGTNAVGDVFISYSVTLYFPQPTNTLLSTRRLDLA
FT                   GALVTASGPRYLLVSRSATVLTMTFRATGTFVISGTYRCLTATTLGLAGGVNVNSITVV
FT                   DNIGTDSAFFINCTVSNLPSVVTFTSTGITSATVHCVRATRQNDVSLI"
XX
SQ   Sequence 1238 BP; 325 A; 270 C; 315 G; 328 T; 0 other;

AY500881  Length: 1238  February 22, 2005 08:35  Type: N  Check: 7071  ..

       1  aagaatacac acacgcagga tagacacatg gcaatggtaa gaagaaacaa
      51  taacacggga atgatcccgg tgagcacaaa gcaattactg gcattaggcg
     101  cggctgctgg ggccacggca ttacagggat ttgttaagaa taatgggatg
     151  gccttcgtag agggggccgt cgatctgact aaaagagcgt acaaagcagt
     201  gcggagaaga ggaggtaaga aacagcagat gattaatcat gtaggtggaa
     251  cgggtggtgc tataatggcg ccggttgcgg tcactagaca acttgtcggt
     301  agtaagccta agtttactgg caggacgtct gggtctgtaa cagttaccca
     351  ccgtgagtat ctgtctcaag tgaataattc cacaggtttc caggttaacg
     401  ggggaattgt cggcaatttg ttacaactca acccgttgaa tggtacattg
     451  ttctcttggt tgcccgcaat agcatccaat tttgatcaat acacattcaa
     501  cagcgttgtg ttacattatg tccccctgtg ttccaccact gaggtgggga
     551  gagtggctat ttactttgat aaggactcgg aagatcctga gcctgctgat
     601  agagttgagt tggcgaatta cagcgtactt aaagagacag ccccttgggc
     651  tgaagcgatg ctcagagtac ccaccgataa ggttaagaga ttttgtgatg
     701  acagttcaac atctgatcac aaacttatcg atttgggcca attgggtatt
     751  gctacatatg gtggcgctgg gactaatgct gtgggggatg ttttcatctc
     801  ctacagtgtt acgttatatt tccctcaacc tacaaataca ctccttagta
     851  ccagaaggct cgaccttgct ggcgctcttg tcacagcatc cggtcctaga
     901  tacctcttgg tctccaggtc cgccactgtc ttaactatga catttcgggc
     951  cactggcacg tttgtcatat ccgggactta tagatgcctg acagcaacga
    1001  cacttggctt ggctggtggg gttaatgtta atagcatcac ggttgtggat
    1051  aacataggaa ctgacagtgc atttttcata aattgcactg tctctaacct
    1101  accatccgtg gtgacattta catccactgg catcacatct gccacagtac
    1151  attgcgtgcg tgcaacgcgg caaaatgatg tttctctaat ttagtgtatc
    1201  ctgcgagggg cctcttgaac aagaccagtt catggata