Sequence of DPV Limonium flower distortion virus

Limonium flower distortion virus isolate Lim 2 coat protein gene, complete cds.

ACC No: AY500882

Dated: 2005-02-14 | Length: 1231 | CRC: -1436739312

                !!NA_SEQUENCE 1.0
ID   AY500882   standard; genomic RNA; VRL; 1231 BP.
XX
AC   AY500882;
XX
SV   AY500882.1
XX
DT   23-SEP-2004 (Rel. 81, Created)
DT   14-FEB-2005 (Rel. 82, Last updated, Version 2)
XX
DE   Limonium flower distortion virus isolate Lim 2 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Limonium flower distortion virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1231
RX   DOI; 10.1007/s00705-004-0331-x.
RX   PUBMED; 15593416.
RA   Koenig R., Verhoeven J.T., Fribourg C.E., Pfeilstetter E., Lesemann D.E.;
RT   "Evaluation of various species demarcation criteria in attempts to classify
RT   ten new tombusvirus isolates";
RL   Arch. Virol. 149(9):1733-1744(2004).
XX
RN   [2]
RP   1-1231
RA   Koenig R.;
RT   ;
RL   Submitted (12-DEC-2003) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1231
FT                   /db_xref="taxon:270257"
FT                   /mol_type="genomic RNA"
FT                   /organism="Limonium flower distortion virus"
FT                   /isolate="Lim 2"
FT   CDS             25. .1191
FT                   /codon_start=1
FT                   /db_xref="GOA:Q64IS6"
FT                   /db_xref="UniProt/TrEMBL:Q64IS6"
FT                   /product="coat protein"
FT                   /protein_id="AAT00604.1"
FT                   /translation="MTMVLRNNNNALAISKKQIAGMVASAAAVAVKNYVANNTTTLIES
FT                   AASLGKKAYSAVRNRNKKSQAIKHIGGMGGAIMAPVAISRQLRGGRPKFSGKAAGSITV
FT                   THREYLTQISNTNGTFTVNGGVTGNLYQLNPLNGTLFSWLPSIAANFDQYSFDKVSIQY
FT                   VPMCSTTEVGRVGIYWDKDSTDLEPQDRVELANFAVLKETPPWGETVLTIPVDRVKRFC
FT                   DDSSTQDHKLIDHGQVGFAVYGGATSNACGDLFITYSVTLYAPQPTANLIETLQINSAD
FT                   TLVERVGPSYAVISKTATTTTFNFRATGIFQTNIIYQSTGVTTISSSGGGSFVEQNTTD
FT                   NLGVATASTAIVRVTSLPATISYINATQGAATAQVVRASLRNTPSIVV"
XX
SQ   Sequence 1231 BP; 349 A; 285 C; 302 G; 295 T; 0 other;

AY500882  Length: 1231  February 22, 2005 08:35  Type: N  Check: 9342  ..

       1  aagtaaacac acacacacac tacgatgaca atggtactac gtaacaacaa
      51  caatgcactt gcaatatcaa agaaacagat cgctggcatg gtggcctctg
     101  ctgctgccgt agccgttaag aactatgtgg ctaacaacac cacgactcta
     151  atcgaatctg ctgcatctct gggtaagaaa gcgtatagcg ctgttcggaa
     201  cagaaataag aaaagccagg ctatcaaaca tattggaggc atgggggggg
     251  caataatggc cccagtcgca atttcccgac aactgagggg tgggaggccc
     301  aaattcagtg ggaaggcggc tgggagtatc actgtaacac accgagagta
     351  tctcacacaa attagcaaca ccaacggaac tttcacagtt aatgggggcg
     401  taaccggtaa cctttatcaa cttaatcctt tgaatggaac tctgttctca
     451  tggctgcctt caatagcggc caattttgat cagtactcct tcgacaaggt
     501  gtccatacag tatgtgccca tgtgtagcac tactgaggtg ggacgggttg
     551  gtatttactg ggataaggac tcaactgatt tggaaccgca ggacagggta
     601  gagttggcta attttgctgt attgaaagaa actcctcctt ggggtgagac
     651  ggtcttaact atacccgtgg atcgtgtgaa acggttctgc gacgacagtt
     701  ctactcaaga ccataagctg atcgatcatg ggcaagtcgg attcgccgtt
     751  tacggtggag ctacatcaaa tgcctgtggg gatctgttca ttacctacag
     801  tgtgacacta tatgcgcctc aaccaacagc caatttgata gaaacactgc
     851  agattaattc tgcagacaca ctcgttgaga gggtaggtcc tagttatgcg
     901  gtcatctcca agactgccac gacaacgact tttaactttc gagcgactgg
     951  catctttcag acgaacatca tataccagtc caccggggtt accaccatca
    1001  gttcatctgg tggtgggtcc tttgtggagc agaatacaac ggataatttg
    1051  ggtgtagcca cagccagcac ggcaatagtt cgtgttacat cattaccagc
    1101  aacgatctca tacattaatg caacgcaagg tgctgcaaca gcgcaagttg
    1151  tgcgtgcaag tctcaggaac acaccatcaa ttgtcgtgta gatgtgtgag
    1201  gggcctcttg aacaagacca gttcatggat a